Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate AZOBR_RS19590 AZOBR_RS19590 ornithine-oxoacid aminotransferase
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__azobra:AZOBR_RS19590 Length = 405 Score = 247 bits (631), Expect = 4e-70 Identities = 147/371 (39%), Positives = 211/371 (56%), Gaps = 19/371 (5%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALT 137 DT+G ++DCL + N GH +P ++ A+ Q +K L S+ + A+ + LAALT Sbjct: 37 DTEGNRYLDCLSAYSAVNQGHCHPKILEAMVQQASKLTLTSRAFRNDQLALFYEELAALT 96 Query: 138 PGKLKYSFFCNSGTESVEAALKLAKAYQS-----PRGKFTFIATSGAFHGKSLGALSATA 192 G K NSG E+VE+A+K + + P + I S FHG+++ +S + Sbjct: 97 -GSHKI-LPMNSGAEAVESAIKTVRKWGYEVRGVPENQAEIIVCSDNFHGRTISIVSFST 154 Query: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252 R F P PGFR VPFG+ A+ AL + AV+LEPIQGE GV++PP G Sbjct: 155 DPDARGGFGPFTPGFRTVPFGDAAALEAALTP------NTVAVLLEPIQGEAGVVIPPAG 208 Query: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312 YL VR LC E +MILDE+QTG+GRTGK+ A EHE V+ D+ + KAL GG P+ A Sbjct: 209 YLRRVRDLCTERNVVMILDEIQTGLGRTGKLLAEEHEGVEADVTLIGKALSGGFYPVSAV 268 Query: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372 ++ EV VL P H +TFGGNPLACA A A + VL+E+ + A +G L+ Q Sbjct: 269 LSNSEVLGVL--KPGQHGSTFGGNPLACAVARAAMRVLVEEGMIDNAAAQGAYFLE---Q 323 Query: 373 LAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLT 432 L ++++EARG+G+++A+E G E R R ++A ++ TIRI PPL Sbjct: 324 LGAIRSNVIREARGRGLMLAVELHPEAGGARRYCEALRARGVLAKDTHD-HTIRIAPPLV 382 Query: 433 LTIEQCELVIK 443 +T EQ + ++ Sbjct: 383 ITREQVDWALE 393 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 27 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 405 Length adjustment: 32 Effective length of query: 427 Effective length of database: 373 Effective search space: 159271 Effective search space used: 159271 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory