Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate AZOBR_RS19635 AZOBR_RS19635 succinate-semialdehyde dehydrogenase
Query= BRENDA::P25553 (479 letters) >FitnessBrowser__azobra:AZOBR_RS19635 Length = 485 Score = 335 bits (858), Expect = 3e-96 Identities = 188/467 (40%), Positives = 278/467 (59%), Gaps = 10/467 (2%) Query: 10 YIDGQFVTWRGDAW----IDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPA 65 Y++G WR DA+ V NPAT ++++ D AE+ R+AI+AA+ A P W A A Sbjct: 14 YVNG---VWR-DAFSGKTFAVTNPATGEELAQVADVGAEETRQAINAADAALPAWRAKTA 69 Query: 66 IERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGE 125 ERA+ LR+ I +++ L+ E GK A EVA+ A +I++ AE +R G+ Sbjct: 70 KERAAILRRWFELIMAAQEDLAVLMTLEQGKPLAEARGEVAYGASFIEWFAEEGKRVYGD 129 Query: 126 IIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNA 185 +I S + I++ K +GV I PWNFP +I RK+ PAL G TIV+KP+E TP +A Sbjct: 130 VIPSFAGNKRIVVLKEPIGVVAAITPWNFPNAMITRKVGPALAAGCTIVVKPAEDTPLSA 189 Query: 186 IAFAKIVDEIGLPRGVFNLVLGRGE-TVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKN 244 +A A++ + G+P GVFN+V G +G EL +P V +S TGS G+ +M +A Sbjct: 190 LALAELAERAGVPAGVFNIVTGSDPVAIGGELTASPIVRKLSFTGSTEVGKILMRQSADT 249 Query: 245 ITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNR 304 + KV LELGG AP IV DDADL+ AVK + S+ NSGQ C CA R+ VQ G+YD F + Sbjct: 250 VKKVSLELGGNAPFIVFDDADLDEAVKGALASKYRNSGQTCVCANRLLVQAGVYDAFAAK 309 Query: 305 LGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVEGKGYY 364 L EA++ ++ GN E + GP+IN A+E+VE+ + A+ +GA+VA GGK G + Sbjct: 310 LAEAVKQIRVGNGMEAG-VTQGPMINGQAVEKVEELMGDALAKGAKVALGGKRHGLGGTF 368 Query: 365 YPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAM 424 + PT+L V EM + EE FGPV P+ F+T DAI MAND+++GL + Y++++ Sbjct: 369 FEPTILTGVTTEMRVAREEIFGPVAPLFKFETEADAIRMANDTEFGLAAYFYSRDIGRVW 428 Query: 425 KAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQ 471 + + L++G IN G ++SGIG K+G+ ++L+ Sbjct: 429 RVAEQLEYGMVGINEGILSTEVAPFGGIKQSGIGREGSKYGVEDFLE 475 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 561 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 485 Length adjustment: 34 Effective length of query: 445 Effective length of database: 451 Effective search space: 200695 Effective search space used: 200695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory