Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Asp/Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate AZOBR_RS20640 AZOBR_RS20640 glutamyl-tRNA amidotransferase subunit C
Query= curated2:B6IN24 (95 letters) >FitnessBrowser__azobra:AZOBR_RS20640 Length = 95 Score = 130 bits (328), Expect = 3e-36 Identities = 67/95 (70%), Positives = 79/95 (83%) Query: 1 MSLDKATVAKIAHLARIRVPEEEQEHLAQELNGILGWVEQLGEVDTDGVQPITSNVAQTL 60 MSLDKATVAKIAHLARI+VP++E +HLA EL+ IL +VEQLGEVDT V P+TS AQTL Sbjct: 1 MSLDKATVAKIAHLARIKVPDDELDHLAGELSQILTFVEQLGEVDTQDVPPMTSVAAQTL 60 Query: 61 RRRQDVVTDGGYPEKVVANAPEGAEHFFAVPKVVE 95 RRR+D VTDGGY + V++N PE AE F+ VPKVVE Sbjct: 61 RRRKDEVTDGGYRDAVLSNGPETAEGFYVVPKVVE 95 Lambda K H 0.314 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 62 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 95 Length of database: 95 Length adjustment: 10 Effective length of query: 85 Effective length of database: 85 Effective search space: 7225 Effective search space used: 7225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.6 bits) S2: 39 (19.6 bits)
Align candidate AZOBR_RS20640 AZOBR_RS20640 (glutamyl-tRNA amidotransferase subunit C)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.17845.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.17845.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.