Align C4-dicarboxylate transport protein 2 (characterized)
to candidate AZOBR_RS21140 AZOBR_RS21140 C4-dicarboxylate ABC transporter
Query= SwissProt::Q9I4F5 (436 letters) >FitnessBrowser__azobra:AZOBR_RS21140 Length = 433 Score = 520 bits (1339), Expect = e-152 Identities = 253/406 (62%), Positives = 322/406 (79%) Query: 3 KQPFYKSLYVQVLVAIAIGIALGHWYPETAVAMKPFGDGFVKLIKMAIAPIIFCTVVTGI 62 K+PFY +L VQVL AI IGI LGH+YP AV MKP GD F+K+IKM I PI+F TVVTGI Sbjct: 9 KKPFYTNLTVQVLTAITIGILLGHFYPALAVQMKPLGDVFIKMIKMVIGPIVFLTVVTGI 68 Query: 63 AGMQSMKSVGKTGGMALLYFEVVSTVALIIGLVVVNVVQPGAGMHVDPNTLDTSKIAAYA 122 + + MK VGK GG A+LYFE+V+T AL +GL+VVN+V+PG+GM++ +L +A YA Sbjct: 69 SSIGDMKKVGKVGGKAILYFEIVTTFALGLGLLVVNLVKPGSGMNIQAGSLKADAVAKYA 128 Query: 123 AAGEKQSTVDFLMNVIPGTVVGAFANGDILQVLFFSVLFGYALHRLGSYGKPVFEFIERV 182 + +T+DFL+N++P V+GAF GD+LQ+LFF+V+FG AL +G GK V + E+V Sbjct: 129 TEAQNHTTIDFLVNIVPDNVIGAFVKGDMLQILFFAVIFGVALSAMGQKGKVVEDMFEKV 188 Query: 183 SHVMFNIINVIMKVAPIGAFGAMAFTIGAYGVGSLVQLGQLMLCFYITCILFVLIVLGGI 242 SH +F +I ++M+VAP+GAFGAM+FTIG YGV SL LGQLM YIT LFV +VLG I Sbjct: 189 SHALFGVIGILMRVAPLGAFGAMSFTIGKYGVSSLTSLGQLMAAVYITMALFVFVVLGSI 248 Query: 243 ARAHGFSILRFIRYIREELLIVLGTSSSESALPRMIDKMEKLGCNKSVVGLVIPTGYSFN 302 AR + FS+L F+RYI++ELLIVLGTSSSES LPRM++KM+K GC+K VVGLVIPTGYSFN Sbjct: 249 ARLYNFSLLTFLRYIKDELLIVLGTSSSESVLPRMMEKMQKFGCSKHVVGLVIPTGYSFN 308 Query: 303 LDGTSIYLTMAAVFIAQATDTPMDITHQITLLLVLLIASKGAAGVTGSGFIVLAATLSAV 362 LDGTSIYL+MAA+FIAQA + + I Q+T+L +L++ SKGAA VTG GF+ LAATLSA Sbjct: 309 LDGTSIYLSMAAIFIAQAFNIDLTIWQQLTILGLLMLTSKGAAAVTGGGFVTLAATLSAT 368 Query: 363 GHLPVAGLALILGIDRFMSEARALTNLVGNGVATVVVSKWCKQLDE 408 GHLP+ GLAL+LG+DRFMSEARA+TNL+GNGVAT+VV+K + DE Sbjct: 369 GHLPIEGLALLLGVDRFMSEARAITNLIGNGVATIVVAKMEGEFDE 414 Lambda K H 0.325 0.140 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 28 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 433 Length adjustment: 32 Effective length of query: 404 Effective length of database: 401 Effective search space: 162004 Effective search space used: 162004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory