Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AZOBR_RS22350 AZOBR_RS22350 ABC transporter
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__azobra:AZOBR_RS22350 Length = 268 Score = 194 bits (494), Expect = 1e-54 Identities = 107/273 (39%), Positives = 168/273 (61%), Gaps = 8/273 (2%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 + + +S++FGG+ A+ D F ++G++ ++IGPNGAGKT++ NCI+G Y+PT G + F Sbjct: 1 IFEARGVSLRFGGVQALTDVGFSIRKGELFSIIGPNGAGKTSMVNCISGRYRPTDGKVYF 60 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYTIL 133 Q + P+ R + + RTFQN+ LF +TVL+N++V +H+ L+K + +T Sbjct: 61 KG----QDITGMTPNHRAS--LGIGRTFQNLALFGHMTVLDNIMVGRHH-LLKNNFFTGS 113 Query: 134 GLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPELL 193 G K E A E+ ++ ++ AG L YG ++R+E+ARA+ P+L+ Sbjct: 114 LYWLTGARKEELAHRREVEEI-IDFLEIQHVRKATAGTLSYGLRKRVELARAIALKPDLI 172 Query: 194 CLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQKISD 253 LDEP AG+N E + + + E G ++++IEHDM VVM+IS V+VLE+G+KI++ Sbjct: 173 LLDEPMAGMNLEEKEDMARYIVDLNEEFGMTVVMIEHDMGVVMDISHRVIVLEFGKKIAE 232 Query: 254 GTPDHVKNDPRVIAAYLGVEDEEVEEVIAAVEQ 286 GTP+ V DPRV AYLG +DEE E V +Q Sbjct: 233 GTPEEVLADPRVKRAYLGEDDEEDEAVAPPPKQ 265 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 268 Length adjustment: 26 Effective length of query: 266 Effective length of database: 242 Effective search space: 64372 Effective search space used: 64372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory