Align phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (EC 1.1.1.343) (characterized)
to candidate AZOBR_RS22360 AZOBR_RS22360 3-hydroxyisobutyrate dehydrogenase
Query= BRENDA::D4GST8 (299 letters) >FitnessBrowser__azobra:AZOBR_RS22360 Length = 296 Score = 75.9 bits (185), Expect = 1e-18 Identities = 68/220 (30%), Positives = 97/220 (44%), Gaps = 23/220 (10%) Query: 3 LGVIGLGRMGRIVVDRVLDAGHEVVAFDLSAEAVAAAADAGAEPADSVADLVDRLGDDKR 62 + IGLG MG ++ +L AGH V+AFDLS A AA DAGA A G+ + Sbjct: 4 IAFIGLGNMGAPMMRNLLKAGHTVLAFDLSEAACTAARDAGATIATGPGAAA---GEAEV 60 Query: 63 IWLMVPAG-------DAVDATLDDLDP-HLDGDDVVVDGGNSHFEESVRRAEACSAAYLD 114 + M+PAG A D + P L D VD ++ F + AEA A +D Sbjct: 61 VVTMLPAGKHVREVYTAPDGIIAKAKPGSLFIDSSTVDVDSARFVAAA--AEAAGHAMVD 118 Query: 115 CGTSGGPAGAELG-FSLMVGGPQWAYDELTPVFDAVATGPDGHGHMGDSGSGHYVKMVHN 173 SGG GAE + MVGG A+ P+ A+ H G G+G K+ +N Sbjct: 119 APVSGGVGGAEAATLTFMVGGSDTAFRRAEPILSAMG---KAIVHTGGPGNGQAAKICNN 175 Query: 174 GVEYALMQAYGEGFELL------AEGRYDLDLESVAKTWN 207 + M E F L ++ +D+ +S + W+ Sbjct: 176 MILGISMLGVSEAFALAEKLGLGSQKLFDVASKSSGQCWS 215 Lambda K H 0.317 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 296 Length adjustment: 26 Effective length of query: 273 Effective length of database: 270 Effective search space: 73710 Effective search space used: 73710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory