Align branched-chain amino acid aminotransferase 2; EC 2.6.1.42 (characterized)
to candidate AZOBR_RS23800 AZOBR_RS23800 2-keto-4-methylthiobutyrate aminotransferase
Query= CharProtDB::CH_012531 (298 letters) >FitnessBrowser__azobra:AZOBR_RS23800 Length = 270 Score = 148 bits (374), Expect = 1e-40 Identities = 103/275 (37%), Positives = 144/275 (52%), Gaps = 13/275 (4%) Query: 6 IFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLEI 65 ++LNG +P +EA++ D G+ GDG+FE IRV G L HL RL +SA + L + Sbjct: 4 VWLNGCLLPAEEARIDPADRGFTLGDGLFETIRVAGGTARHLGRHLARLADSAALLGLPL 63 Query: 66 PYSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQLSLFPQ 125 P+ + I G +R+ ++RG G G+ P P ++ ++L P Sbjct: 64 PHDAAALAVAAEALIAAQGRVEGVLRITLTRGTGARGVLPPVDAVPTLL-----MTLAPA 118 Query: 126 EYYEKGIP-VVTVATRRNRPDVLSPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQGYVA 184 + V+ TRRN LS +VKSLNYL++IL R EA G EAL+LN G +A Sbjct: 119 PPPAGPVEAVIARTTRRNEHSPLS-RVKSLNYLDSILARQEAATRGAGEALLLNGAGRLA 177 Query: 185 EGSGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVADEV 244 E S N+FIV+ + +TPP + GAL GI R ILE G D E + D+ A+E Sbjct: 178 ESSVANLFIVRDGRPLTPPVAEGALPGIRRALILERG-----DAGEAPLSVTDLLGAEEA 232 Query: 245 FLTGTAAEVIAVTTVDGRTIGLGQTGPHTNRLLEE 279 FLT + + VDGR IG G GP T LL++ Sbjct: 233 FLTNILG-LRPLLRVDGRAIGAGTVGPVTAALLKD 266 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 270 Length adjustment: 26 Effective length of query: 272 Effective length of database: 244 Effective search space: 66368 Effective search space used: 66368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory