Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate AZOBR_RS24105 AZOBR_RS24105 enoyl-CoA hydratase
Query= curated2:Q52995 (257 letters) >FitnessBrowser__azobra:AZOBR_RS24105 Length = 256 Score = 145 bits (367), Expect = 6e-40 Identities = 88/254 (34%), Positives = 142/254 (55%), Gaps = 4/254 (1%) Query: 3 YETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGS-EKAF 61 ++ +L E +G VG+ITLNRP+ LNA NA + EL A F+ V AI+L G+ ++AF Sbjct: 2 FKFILTEVRGPVGIITLNRPEILNAWNAAMRDELVVAFDQFENQDGVRAIILTGAGDRAF 61 Query: 62 AAGADIKEMQ--GLDFVDGYLADFLGGWEHVANARKPMIAAVSGFALGGGCELAMMCDFI 119 AG D+ E + D + ++A++ + + KP+I A++G A G ++A++ DF Sbjct: 62 GAGQDLNETKTFNADRAEEWVAEWERLYHRMRTLSKPLIIALNGVAAGSAFQVALLGDFR 121 Query: 120 IASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRV 179 I + GQPEI G I G + +G A+ MDL L+GR+MDA E+ R GL++R+ Sbjct: 122 IGHAGVRMGQPEINSG-IASTTGPWIMKEMIGLARTMDLTLSGRLMDAEESHRIGLINRI 180 Query: 180 VAPDRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQ 239 V DR++ E+L AE++A+ A + K+ E + L R+ + +A+ + Sbjct: 181 VPQDRVMAESLALAEELAAKPPVAMRLDKQRFREMTEAGFRDALAAGVRIQREAYASGEP 240 Query: 240 KEGMAAFVAKRKAE 253 M F+AKR A+ Sbjct: 241 ARMMEEFLAKRAAK 254 Lambda K H 0.321 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 256 Length adjustment: 24 Effective length of query: 233 Effective length of database: 232 Effective search space: 54056 Effective search space used: 54056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory