Align C4-dicarboxylate ABC transporter permease (characterized, see rationale)
to candidate AZOBR_RS25410 AZOBR_RS25410 C4-dicarboxylate ABC transporter permease
Query= uniprot:A0A165IVI0 (170 letters) >FitnessBrowser__azobra:AZOBR_RS25410 Length = 176 Score = 43.9 bits (102), Expect = 1e-09 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 3/110 (2%) Query: 2 SSPAQDAVPQSRFARVSQVLMASCLGVMAVAVFINVVLRYGFGSGVAASEELSRLLFVWM 61 S+PA D P+ A + + L A+ + VM + F NVV RY +A +EE + +L V M Sbjct: 8 SAPAPDK-PRVPLA-IEEALAAAAIAVMGLITFANVVTRYTTNVSLAFTEEYAIVLMVAM 65 Query: 62 VFIGAAAAYPAGEHMAFTSLAGLLAKRPVAFAALTAV-IRLLVMAACAML 110 +GA+ A H+ L R A L A+ + LV A +L Sbjct: 66 TLLGASVAVARDHHIRIGFLIDRFGPRGRLRAELLALGVTALVFGALVVL 115 Lambda K H 0.328 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 68 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 170 Length of database: 176 Length adjustment: 18 Effective length of query: 152 Effective length of database: 158 Effective search space: 24016 Effective search space used: 24016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory