Align SDR family oxidoreductase (characterized, see rationale)
to candidate AZOBR_RS25420 AZOBR_RS25420 oxidoreductase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__azobra:AZOBR_RS25420 Length = 267 Score = 140 bits (352), Expect = 3e-38 Identities = 94/265 (35%), Positives = 141/265 (53%), Gaps = 19/265 (7%) Query: 3 ASTGRLAGKTVLITAAAQ-----GIGRASTELFAREGARVIATDISKTHLEELASIAGVE 57 A GRLAGK L+ A G G+A+ +AREGARV+A D EE A++ E Sbjct: 4 AKAGRLAGKVALVFGAGSSAPGWGNGKATAVAYAREGARVVAVDKVTEAAEETAALIAAE 63 Query: 58 THL-LDVTDD--------DAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNL 108 L VT D A++ +A G +D+L N G G +E +++W + Sbjct: 64 GFAALAVTADVTRGPEVAAAVERTLAAHGRIDILHNNVGITEPGGPVETSEESWRRVLDT 123 Query: 109 NAKAMFHTIRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAAD 168 + +F T + VLP M+A+++G+IVNI+S A +++ Y A+KA V T +VA Sbjct: 124 DLTGVFLTCKQVLPVMVAQRSGAIVNISSIA-AIRWAYPYIGYAAAKAGVNQFTVAVARQ 182 Query: 169 FVSQGIRCNAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAA 228 GIR NA+ PG I++P +I+ K+ G E+R A A P+G G A ++AA Sbjct: 183 HARDGIRANAVMPGLIDTPMARSQIAAHYKDAG----EMRRARDALCPLGFQGTAWDIAA 238 Query: 229 LALYLASDESNFTTGSIHMIDGGWS 253 +++LASDE+ + TG +DGG S Sbjct: 239 ASVFLASDEARYITGVCLPVDGGLS 263 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 267 Length adjustment: 24 Effective length of query: 230 Effective length of database: 243 Effective search space: 55890 Effective search space used: 55890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory