Align citrate (pro-3S)-lyase (EC 4.1.3.6) (characterized)
to candidate AZOBR_RS25430 AZOBR_RS25430 Citrate lyase
Query= BRENDA::Q8N0X4 (340 letters) >FitnessBrowser__azobra:AZOBR_RS25430 Length = 283 Score = 149 bits (377), Expect = 6e-41 Identities = 93/292 (31%), Positives = 150/292 (51%), Gaps = 19/292 (6%) Query: 43 IPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPT 102 + RR+ L+VPG + K D +D ED VA ++K+EAR + T + Sbjct: 7 VRRRSFLFVPGLRPDRFAKALETGADVVCIDLEDAVAPDRKDEARALSLPTYHEQRAARA 66 Query: 103 EKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQ 162 EK +R+NS+ S D++ +L+ LP +L+LPKV S +E++ AD R + Sbjct: 67 EKALRINSIRSPEGIADVDAILKLETLPDALVLPKVRSADEVRIVADLL------RSRPE 120 Query: 163 PMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDI 222 P+ L +ETA GL + E + V LF+ AV D A + + + L Sbjct: 121 PVALYVIIETAEGLERVAEIAEADPSI---VALFIGAV-----DLSAELRVRPTWDAL-- 170 Query: 223 LYARQKIVVIAKAFGLQAIDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQE 282 LYAR +IV A G+ +D+ ++D D AGL ++R AA+GFTGK +IHP + + Sbjct: 171 LYARSRIVHAAARAGVAVLDVPFLDLEDAAGLETEARRAAALGFTGKALIHPGHLPAIHA 230 Query: 283 QFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLA 334 F+P+ E++ A +IAAF+E G G +I+ P++++ + + A Sbjct: 231 AFTPTEEEVAHARRIIAAFQEST---TGLVVVDGKLIEKPVIREMERILFTA 279 Lambda K H 0.319 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 283 Length adjustment: 27 Effective length of query: 313 Effective length of database: 256 Effective search space: 80128 Effective search space used: 80128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory