Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AZOBR_RS25470 AZOBR_RS25470 ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >FitnessBrowser__azobra:AZOBR_RS25470 Length = 297 Score = 169 bits (427), Expect = 9e-47 Identities = 104/294 (35%), Positives = 162/294 (55%), Gaps = 17/294 (5%) Query: 6 QQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFAGLP 65 QQ++NG+ +GS Y L A+G+T+++G++ ++N AHG +FM G F L L GLP Sbjct: 4 QQIVNGIVVGSTYALFALGFTLIFGVLHVLNLAHGAVFMWGAFTGLFAVTAL-----GLP 58 Query: 66 VAVLLLVMLVVAMLMTSLWNWTIERVAYRPLR--GSFRLAPLITAIGMSITLSNFIQVTQ 123 L VAML L + ++ VA+RPLR GS A +I+++G++ L + Q+ Sbjct: 59 ----LPAAFAVAMLAAGLLSVLVDAVAFRPLRRRGSPEFAAIISSLGVAQILMSAAQIAS 114 Query: 124 GPRNKPIP----PMVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRAT 179 + + P P+V YQ + VSL+QI+I+ AVL+ + T+ GR RA Sbjct: 115 NTQVQRFPFGTFPIV--FYQVFGLRVSLQQIVIVGSVAVLVAALLAFLFATSFGRQIRAV 172 Query: 180 EQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAAV 239 + A+LLGVN ++TF + ALA AG + + + F G ++ F V Sbjct: 173 AISERTASLLGVNPGAVHALTFFLCGALAGAAGVIIGIAFNSVHFLMGEPYLLRGFVVIV 232 Query: 240 LGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILG 293 LGG+GS+ GAV GGLL G+I++L A+ + A D F +L +L+ +P+G G Sbjct: 233 LGGLGSVAGAVVGGLLFGMIQTLSVAFLSSALSDAILFGLLFVILLLRPSGFFG 286 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 297 Length adjustment: 27 Effective length of query: 273 Effective length of database: 270 Effective search space: 73710 Effective search space used: 73710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory