Align proline dehydrogenase (EC 1.5.5.2) (characterized)
to candidate AZOBR_RS25515 AZOBR_RS25515 hypothetical protein
Query= BRENDA::Q5JFG7 (386 letters) >FitnessBrowser__azobra:AZOBR_RS25515 Length = 379 Score = 168 bits (426), Expect = 2e-46 Identities = 116/383 (30%), Positives = 198/383 (51%), Gaps = 30/383 (7%) Query: 10 SEITIIGGGIVGVTIAHELAKRGEEVTVI--EKRFIGSGSTFRCGTGIRQQFNDEANVQV 67 ++I +IGGG G++ A L + +++V+ ++ T RCG G R Q+ N+++ Sbjct: 3 ADIAVIGGGAYGLSAALWLRRLRPDLSVLLLDRSDFAGNETGRCGAGFRAQWGAAGNIRL 62 Query: 68 MKRSVELWKKYSEEYGFP----FQQTGYLFLLYDDEEVETFKRNIAIQNKFGVPTRLITP 123 + S+ ++ ++EE+G+P F+Q GYL L + +E+++ +RNIA+Q +FGV + L+T Sbjct: 63 CQESLPSYENFAEEFGYPEGIEFKQDGYLILAHGEEQLDQLRRNIALQARFGVDSALLTA 122 Query: 124 EEAKEIVPLLDISEVVAASWNPTDGKASPFHSTAKFALHAEEFGAKLVEYTEVKDFIIEN 183 EE + P L+ + VV S+ DG SPF F A G + ++ N Sbjct: 123 EEVARLAPGLNPAGVVGGSFCARDGSLSPFRVLDGFHRAALRSGVVIRHGVTIESIEPRN 182 Query: 184 GEIKGLKTSRGTIKTGIVVNATNAWAKLINAMAGIRTKIPIEPYKHQAVITQPIKKGSVK 243 G + L+ +I+ G VV AT+ ++ + + IP++PY +QA +T+P+ + Sbjct: 183 GAFR-LRAGGESIEAGRVVVATD--TRIPQLLGPLGIDIPVQPYPNQAFVTEPLPP-RLG 238 Query: 244 PMVISFRYGHAYLTQTSHGGII-------GGVGYEEGPTYDLNPTYEFLREVSYYFTKII 296 P V+SF + +L QT G ++ +G + PT DL P + + ++ Sbjct: 239 PCVVSFAH-EMFLNQTVRGSVVVVASDRRRALGADARPTADLFP------RAAAHAIDLL 291 Query: 297 PALRELLILRTWAGYYAKTPDSNPAIGKIEELSDYYIAAGFSGHGFMMAPAVAEMVADLI 356 PAL +LR+WAG Y+ TPD +G+ L ++A GFM APA ++A L+ Sbjct: 292 PALGTARLLRSWAGLYSITPDMLAVLGE-TALPGLFVALS-GAKGFMTAPAAGRLLAHLV 349 Query: 357 TKGKTDLPAWW--YDPYRFERGE 377 G+ +P W+ P RF GE Sbjct: 350 -DGQA-VPDWFARLSPARFASGE 370 Lambda K H 0.318 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 379 Length adjustment: 30 Effective length of query: 356 Effective length of database: 349 Effective search space: 124244 Effective search space used: 124244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory