Align ABC transporter for Glycerol, permease component 1 (characterized)
to candidate AZOBR_RS25585 AZOBR_RS25585 ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_793 (298 letters) >FitnessBrowser__azobra:AZOBR_RS25585 Length = 301 Score = 116 bits (290), Expect = 7e-31 Identities = 83/269 (30%), Positives = 137/269 (50%), Gaps = 11/269 (4%) Query: 12 AWFLILPVIICVAFSAILPLMTVVNYSVQDIISPERRVF--VGTEWFAAVMRDEELHAAL 69 AW +LP++I +A A PL V +S D F VG + + +MRD A+ Sbjct: 18 AWLFLLPMLIVLAGVAGWPLFRTVFFSFTDATLATLEGFQGVGLDNYLWLMRDPVWWRAV 77 Query: 70 WRQLTFSLAVLAVEIPLGILLAL----SMPAQGWKSSAVLVVVALSLLIPWNVVGTIWQ- 124 W L F++ + +E LG+ +AL +P +G +AVL+ A+ ++ + G ++ Sbjct: 78 WNTLVFTVVSVGIETALGLGIALILNAHLPGRGLLRAAVLIPWAIPTVVSAQMWGWMFHD 137 Query: 125 IYGRADIGLMGRMLQEMGIEYSYTGNATQAWLTVLLMDVWHWTPLVALLAFAGLRSIPDA 184 +YG + LMG L + ++T + A V+ +DVW TP +ALL A L+ +P Sbjct: 138 LYGVVNAILMGLGL--IAEPRAWTADPDLALPVVIAVDVWKSTPFMALLILAALQMLPRD 195 Query: 185 YYQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPGNATTF 244 Y+AAR+DG VF I LP +R LM+AVL R +D+ ++ +VLTG +T Sbjct: 196 LYEAARVDGVHPVKVFVRITLPLIRPALMVAVLFRTLDALRVFDLMYVLTGN--SRSTMS 253 Query: 245 LSQYLTTKAVGQFDLGPAAAFSLIYFFII 273 +S Y + D+G +A + + ++ Sbjct: 254 MSVYARQYLIDFQDVGYGSAAATLLVLVL 282 Lambda K H 0.328 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 301 Length adjustment: 27 Effective length of query: 271 Effective length of database: 274 Effective search space: 74254 Effective search space used: 74254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory