Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AZOBR_RS25635 AZOBR_RS25635 high-affinity branched-chain amino acid ABC transporter (permease protein) (fragment)
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__azobra:AZOBR_RS25635 Length = 328 Score = 193 bits (491), Expect = 6e-54 Identities = 125/353 (35%), Positives = 188/353 (53%), Gaps = 35/353 (9%) Query: 112 LIALLLYPMVVVAIKG-PQGSLTYVDNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFY 170 L+ALL++ + + G +G + N LI+++L+ +++V G+AGLL LG+ AFY Sbjct: 6 LLALLVFVGLPAVLAGFDRGYFYQIANLA---LIFILLSASMHLVTGVAGLLHLGHAAFY 62 Query: 171 AVGAYSYALLSSYFGLSFWVLLPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIR 230 VGAY+ ALLS+ FGL F V LPLSG+ AAL ++ P +RL Y A+ TLA G+++ Sbjct: 63 GVGAYTAALLSTKFGLGFTVTLPLSGLVAALIAFLVALPTMRLVSIYFAVATLAIGQMLY 122 Query: 231 LVLINWTDVTKGTFGISSIPKATLFGIPFDATAGGFAKLFHLPISSAYYKIFLFYLILAL 290 LV++NW + TKG GI LFG + YY + ++AL Sbjct: 123 LVMLNWVEFTKGPNGIIVTKGLELFGFSLSGRL------------ATYYTV---ATVVAL 167 Query: 291 CMLTAYVTIRLRRMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFA 350 C+L RL G A ++RED+ ++G++T K+ AF A FAG AGS +A Sbjct: 168 CVLAIG---RLSHSYYGNALRSIREDDQCADAMGVSTARLKMEAFTLSAFFAGVAGSLWA 224 Query: 351 ARQGFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGP 410 G++SP F F ES +ILA+VV+GG+GSL G I A++++ E LR FG Sbjct: 225 HMTGYISPGDFKFSESILILAMVVVGGLGSLPGAVIGALLLILLPEGLR-------AFGD 277 Query: 411 DFTPELYRMLIFGLAMVVVMLFKPRGFVGSREPTAFLRERKAISGSFIKEGHG 463 +R ++ GL M + +L P+G +G R + + +G G Sbjct: 278 ------FRNIMVGLVMFLSILLLPKGLLGEVSALQLARRQLGAAWRNTVKGEG 324 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 328 Length adjustment: 30 Effective length of query: 433 Effective length of database: 298 Effective search space: 129034 Effective search space used: 129034 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory