Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate AZOBR_RS25635 AZOBR_RS25635 high-affinity branched-chain amino acid ABC transporter (permease protein) (fragment)
Query= uniprot:G8ALI9 (505 letters) >FitnessBrowser__azobra:AZOBR_RS25635 Length = 328 Score = 203 bits (516), Expect = 8e-57 Identities = 117/293 (39%), Positives = 167/293 (56%), Gaps = 23/293 (7%) Query: 175 IGILLLTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLAHYFGFSFWVCLPLAGF 234 I L L +I+L +++V G+AGLL LG+ AFY VGAY+ ALL+ FG F V LPL+G Sbjct: 30 IANLALIFILLSASMHLVTGVAGLLHLGHAAFYGVGAYTAALLSTKFGLGFTVTLPLSGL 89 Query: 235 LAAMSGVLLGFPVLRLRGDYFAIVTLGFGEIIRIILINWYQFTGGPNGISGIPRPSFFGI 294 +AA+ L+ P +RL YFA+ TL G+++ ++++NW +FT GPNGI FG Sbjct: 90 VAALIAFLVALPTMRLVSIYFAVATLAIGQMLYLVMLNWVEFTKGPNGIIVTKGLELFG- 148 Query: 295 ADFTRTPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVLALVVNLFTMRVRKLPLGRAWEA 354 FS R+ Y + V+AL V L R+ G A + Sbjct: 149 ---------------------FSLSGRLATYYTVATVVALCV-LAIGRLSHSYYGNALRS 186 Query: 355 LREDDIACASLGINRTNMKLAAFAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAI 414 +REDD ++G++ +K+ AF ++A F G AGS +A G+ISP F F ES +ILA+ Sbjct: 187 IREDDQCADAMGVSTARLKMEAFTLSAFFAGVAGSLWAHMTGYISPGDFKFSESILILAM 246 Query: 415 VVLGGMGSQIGVVVAAFLVIGLPEAFRELADYRMLAFGMGMVLIMLWRPRGLL 467 VV+GG+GS G V+ A L+I LPE R D+R + G+ M L +L P+GLL Sbjct: 247 VVVGGLGSLPGAVIGALLLILLPEGLRAFGDFRNIMVGLVMFLSILLLPKGLL 299 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 328 Length adjustment: 31 Effective length of query: 474 Effective length of database: 297 Effective search space: 140778 Effective search space used: 140778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory