Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate AZOBR_RS25880 AZOBR_RS25880 ABC transporter ATP-binding protein
Query= TCDB::G3LHY9 (356 letters) >FitnessBrowser__azobra:AZOBR_RS25880 Length = 362 Score = 443 bits (1139), Expect = e-129 Identities = 219/361 (60%), Positives = 270/361 (74%), Gaps = 5/361 (1%) Query: 1 MARITLDHIRHAYGANPKSDKDYSLKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQ 60 MARI L + H+Y +NPK D DY+LK + H W GGAYALLGPSGCGKTTLLNIISGLL Sbjct: 1 MARIDLQSLGHSYTSNPKGDDDYALKPMTHVWEQGGAYALLGPSGCGKTTLLNIISGLLT 60 Query: 61 PSHGRILFDGKDVTNLSTQSRNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRV 120 PS GR+LFDGKDVT L T++RNIAQVFQFPV+YDTMTVY+NLAFPLRNRG+ A +D RV Sbjct: 61 PSEGRVLFDGKDVTALPTEARNIAQVFQFPVVYDTMTVYENLAFPLRNRGLRGAPLDARV 120 Query: 121 RDILEMIDLASWARRKAQGLTADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLR 180 R+I ++DL + R+ + LTAD KQKISLGRGLVR DV AILFDEPLTVIDPH+KW LR Sbjct: 121 REIAGLLDLTADLNRRGRNLTADAKQKISLGRGLVRPDVAAILFDEPLTVIDPHLKWELR 180 Query: 181 SQLKRLHKQFGFTMVYVTHDQTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYF 240 S+LK LH+ TM+YVTHDQTEALTFA+KVVVM+DG++VQ+G P ELFERP+H FVG+F Sbjct: 181 SKLKALHRALDLTMIYVTHDQTEALTFADKVVVMHDGRVVQVGRPQELFERPAHVFVGHF 240 Query: 241 IGSPGMNFMPARIEGSTVKVGDETLTLEYA-PKTSGTAKTELGIRPEFIRL---GREGMP 296 IGSPGMN +PA + G +VG + L P +G AK E+G+RPEF L G G+P Sbjct: 241 IGSPGMNVLPAEVSGRAARVGGHVIALRRGYPTLNGGAKIEIGVRPEFATLAPAGAGGLP 300 Query: 297 ITISKVEDIGRQKIVRARFADQPIAIVVPEDADIPAD-ARVTFDPSAISIYADSWRVGRE 355 + + +++D+GR +I R + P+A VPED + D A + DP+ + +YAD V E Sbjct: 301 VRVRRLDDLGRTRIARVELSGLPMAATVPEDLTLVGDEASLLLDPAMVHVYADGTLVEGE 360 Query: 356 A 356 A Sbjct: 361 A 361 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 362 Length adjustment: 29 Effective length of query: 327 Effective length of database: 333 Effective search space: 108891 Effective search space used: 108891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory