Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate AZOBR_RS26270 AZOBR_RS26270 putative enoyl-CoA hydratase
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__azobra:AZOBR_RS26270 Length = 255 Score = 151 bits (381), Expect = 1e-41 Identities = 101/257 (39%), Positives = 130/257 (50%), Gaps = 4/257 (1%) Query: 1 MPEFKVDARGPIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAF 60 MPE G I I TI E +RNA M + + VR VV+TGAGD AF Sbjct: 1 MPEITAQTEGAIRILTISNEPKRNAFEGTMAADFLGHLNDADGDAAVRVVVVTGAGDIAF 60 Query: 61 CAGADLKERATMAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLR 120 +G DL E A+ A G R + + V IAA+NG LAL+CDLR Sbjct: 61 SSGHDLNEIASGAHAATNL---GEAPFLRPRDMTKPV-IAAVNGHCYAAALILALSCDLR 116 Query: 121 VAAPAAELGLTEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRL 180 VA+ A G +LG++P GG RL RL+ RA +L+LTA + A EA+ G NRL Sbjct: 117 VASVNATFGSPGARLGMLPEGGQIGRLPRLMSSARALELMLTANPLPADEAYRTGFVNRL 176 Query: 181 APEGHLLAVAYGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDR 240 A +G L A LA ++ +NAP VA K + G +D A A E + K D Sbjct: 177 AGQGEALQEALVLARAIAKNAPSVVAAIKAGVILGEREGIDAAGAYEATVARRLEKAADA 236 Query: 241 LEGLRAFAEKRAPVYKG 257 EG+ AF EKRAPV++G Sbjct: 237 REGVSAFLEKRAPVFRG 253 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 255 Length adjustment: 24 Effective length of query: 234 Effective length of database: 231 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory