Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate AZOBR_RS26375 AZOBR_RS26375 hypothetical protein
Query= reanno::Smeli:SM_b21112 (281 letters) >FitnessBrowser__azobra:AZOBR_RS26375 Length = 293 Score = 169 bits (428), Expect = 7e-47 Identities = 90/210 (42%), Positives = 128/210 (60%), Gaps = 15/210 (7%) Query: 75 CIGLNYSDHAAETGAT------------VPPEPIIFMKATSAIVGPNDDLVLPRG-SEKT 121 C+G NY DHA E + +P PI F K ++ D + P G S+ Sbjct: 79 CVGKNYHDHAHEFTRSGFDAGSKVATDAIPEAPIFFTKPPETVIANGDPIRYPHGVSDSL 138 Query: 122 DWEVELGIVIGKTAKYVSEAEALDYVAGYCTVHDVSERAFQTERHGQWTKGKSCDTFGPT 181 D+E ELG+VIGK + +++AEA D+V GY ++D++ R +Q+ RH QW GKS DTF P Sbjct: 139 DYEAELGVVIGKGGRGITKAEAYDHVFGYVIINDMTARDWQS-RHKQWFLGKSFDTFCPM 197 Query: 182 GPWLVTKDEVADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSLRPGDIIST 241 GPWL T DEV D +LA+ VN E Q+ +T+ +++ ++ LS ++L PGDII+T Sbjct: 198 GPWLATTDEV-DAANLALRCWVNDELRQNANTRDLIFDIPTMIETLSAGITLYPGDIIAT 256 Query: 242 GTPPGVGMGMKPPRYLKAGDVVELGIEGLG 271 GTP GVG+G PP++LK GD V + I+GLG Sbjct: 257 GTPAGVGIGFNPPKFLKPGDRVTIEIDGLG 286 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 293 Length adjustment: 26 Effective length of query: 255 Effective length of database: 267 Effective search space: 68085 Effective search space used: 68085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory