Align D-xylonate dehydratase subunit (EC 4.2.1.25; EC 4.2.1.82) (characterized)
to candidate AZOBR_RS26635 AZOBR_RS26635 mandelate racemase
Query= metacyc::MONOMER-18070 (393 letters) >FitnessBrowser__azobra:AZOBR_RS26635 Length = 393 Score = 126 bits (317), Expect = 9e-34 Identities = 109/362 (30%), Positives = 163/362 (45%), Gaps = 20/362 (5%) Query: 26 VLVRVTTNDGRVGWGETVSALRAEAVAN-FVKKINTVLKGNDVFNVEKNRLEWYKHDFNM 84 +LVR+TT+DG VGWGE AE + + + L G + + Y + Sbjct: 33 LLVRITTDDGLVGWGEGGQYGPAEPPESCIIDVLAPRLIGRRADQPVRVFEDLYSFCRDF 92 Query: 85 TISLESTTAYSAVDIASWDIIGKELGAPLYKLLGGKTRDKVLVYANGWYQNCVKPEDFAE 144 A SA+DIA WD+ GK L P++ L+GG RDKV Y G C P+ F + Sbjct: 93 GQKGTYIEALSAIDIALWDLWGKSLNRPVHALMGGAFRDKVAAYGTG----CYYPDYFRD 148 Query: 145 KAKEIVKMGYKALKFDPFGPYFNDISKKGLDIAE--ERVKAVREAVGDNVDILIEHHGRF 202 + + + +A ++ G I L IA+ ERV VR+ +G + I+++ + + Sbjct: 149 TPRMMAALAEEAQRYREAGLPAIKIKIGLLPIAQDIERVALVRDVLGPDTLIMVDANHAY 208 Query: 203 NANSAIMIAKRLEKYNPLFMEEPIHPEDVEGLRKYRNNTSLRIALGERIINKQQALYFMK 262 N AI I + LE+++ + EEP+ PED +G R+ R++ + IA GE + + Sbjct: 209 NTAGAIRIGRALERFDVRWFEEPVPPEDRQGYRRVRDSIDVPIAGGECEYTRYGFRELLA 268 Query: 263 EGLVDFLQADLYRIGGVTETKKVVGIAETFDVQMAFHNAQGPILNAVTLQFDAFIP---- 318 G +D Q DL GG TE +K++ + V H I A LQ A P Sbjct: 269 GGCIDIAQPDLCCAGGFTEWQKILALTTAHGVMTVPHIWGSGIALAAALQALATAPLVPY 328 Query: 319 --------NFLIQESFYDWFPSWKRELIYNGTPIDNGYAIIPERPGLGVEVNEKMLDSLK 370 N + E P LI N T +D G +P GLGVEV+ L Sbjct: 329 TALGVPLQNEPMVEFDRTHNPLRDDLLIDNFTLVD-GCLALPGGAGLGVEVDPDQLARYT 387 Query: 371 VK 372 V+ Sbjct: 388 VR 389 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 393 Length of database: 393 Length adjustment: 31 Effective length of query: 362 Effective length of database: 362 Effective search space: 131044 Effective search space used: 131044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory