Align D-galactonate dehydratase; EC 4.2.1.6 (characterized)
to candidate AZOBR_RS26635 AZOBR_RS26635 mandelate racemase
Query= CharProtDB::CH_024133 (382 letters) >FitnessBrowser__azobra:AZOBR_RS26635 Length = 393 Score = 134 bits (336), Expect = 6e-36 Identities = 108/365 (29%), Positives = 177/365 (48%), Gaps = 29/365 (7%) Query: 16 MFLKIETDEGVVGWGEPVIEGRARTVEAAVHE-LGDYLIGQDPSRINDLWQVMYR--AGF 72 + ++I TD+G+VGWGE G A E+ + + L LIG+ + +++ +Y F Sbjct: 33 LLVRITTDDGLVGWGEGGQYGPAEPPESCIIDVLAPRLIGRRADQPVRVFEDLYSFCRDF 92 Query: 73 YRGGPILMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSW------VGGDRP- 125 + G + A++ ID ALWD+ GK LN PV LMGG RDK+ AY D P Sbjct: 93 GQKGTYI-EALSAIDIALWDLWGKSLNRPVHALMGGAFRDKVAAYGTGCYYPDYFRDTPR 151 Query: 126 --ADVIDGIKTLREIGFDTFKLNGCEELGLIDNSRAVDAAVNTVAQIREAFGNQIEFGLD 183 A + + + RE G K+ ++GL+ ++ ++ VA +R+ G +D Sbjct: 152 MMAALAEEAQRYREAGLPAIKI----KIGLLPIAQDIER----VALVRDVLGPDTLIMVD 203 Query: 184 FHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPKLAAQTHIPLAAGERMFSRFDF 243 + + A + + LE + + EEPV E + Y ++ +P+A GE ++R+ F Sbjct: 204 ANHAYNTAGAIRIGRALERFDVRWFEEPVPPEDRQGYRRVRDSIDVPIAGGECEYTRYGF 263 Query: 244 KRVLEAGGISILQPDLSHAGGITECYKIAGMAEAYDVTLAPHCPLGPIALAACLH----- 298 + +L G I I QPDL AGG TE KI + A+ V PH IALAA L Sbjct: 264 RELLAGGCIDIAQPDLCCAGGFTEWQKILALTTAHGVMTVPHIWGSGIALAAALQALATA 323 Query: 299 --IDFVSYNAVLQEQSMGIHYNKGAELLDFVKNKEDFSMVGGFFKPLTKPGLGVEIDEAK 356 + + + LQ + M + +++ L ++F++V G GLGVE+D + Sbjct: 324 PLVPYTALGVPLQNEPM-VEFDRTHNPLRDDLLIDNFTLVDGCLALPGGAGLGVEVDPDQ 382 Query: 357 VIEFS 361 + ++ Sbjct: 383 LARYT 387 Lambda K H 0.321 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 393 Length adjustment: 30 Effective length of query: 352 Effective length of database: 363 Effective search space: 127776 Effective search space used: 127776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory