Align 2-pyrone-4,6-dicarboxylate lactonase (EC 3.1.1.57) (characterized)
to candidate AZOBR_RS26895 AZOBR_RS26895 2-pyrone-4 6-dicarboxylate hydrolase
Query= BRENDA::D1MW98 (305 letters) >FitnessBrowser__azobra:AZOBR_RS26895 Length = 291 Score = 403 bits (1035), Expect = e-117 Identities = 192/291 (65%), Positives = 223/291 (76%), Gaps = 7/291 (2%) Query: 13 WYANPSKPQFKLPAGAVDAHCHVFGPGNEFPFAPERKYTPCDASKAQLYALRDHLGFARN 72 ++ NPSKP + P GAVDAHCHVFGP + FP+APERKYTPCDA K +L+ALRD LGFARN Sbjct: 8 FHPNPSKPAYTPPPGAVDAHCHVFGPADRFPYAPERKYTPCDAPKERLFALRDELGFARN 67 Query: 73 VVVQATCHGADNRAMVDACKSSGGKARGVATVKRSISDAELQELHDAGVRGVRFNFVKRL 132 V+VQATCHG DNRA+VDA ++S G ARGVA+V SI++ EL ELH+AGVRGVRFNFVKRL Sbjct: 68 VIVQATCHGKDNRALVDALRASNGLARGVASVGPSITEGELAELHEAGVRGVRFNFVKRL 127 Query: 133 VDFTPKDELMEIAGRIAKLGWHVVIYFEAVDLPELWDFFTALPTTVVVDHMGRPDVTKGV 192 VD TPK+ + IA RIA GWH+V+YFEA DL +L F LPTT+VVDHMGRPD+ KGV Sbjct: 128 VDATPKEVFLGIADRIATFGWHIVVYFEAPDLDDLTPFLRELPTTIVVDHMGRPDIAKGV 187 Query: 193 DSEEFALFLKFMREHKNVWSKVSCPERLSVSGPKALHGEQNAYQDVVPFARRVVEEFPER 252 D +F F+ M E+ VWSKVSCPERLSV GP +Y DVVPFAR +V+ F +R Sbjct: 188 DHPQFQKFVALMAENPKVWSKVSCPERLSVQGPP-------SYDDVVPFARLLVDRFTDR 240 Query: 253 VLWGTDWPHPNLKDHMPDDGLLVDFIPHIAPTAQLQQKLLVDNPMRLYWPE 303 VLWGTDWPHPN+ HMPDDG LVD IP IA + LLVDNPMRLYW E Sbjct: 241 VLWGTDWPHPNMTSHMPDDGHLVDVIPRIATDEAKRTALLVDNPMRLYWSE 291 Lambda K H 0.321 0.138 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 291 Length adjustment: 26 Effective length of query: 279 Effective length of database: 265 Effective search space: 73935 Effective search space used: 73935 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory