Align (S)-3-hydroxybutanoyl-CoA dehydrogeanse (EC 1.1.1.35) (characterized)
to candidate AZOBR_RS26995 AZOBR_RS26995 3-hydroxyacyl-CoA dehydrogenase
Query= metacyc::MONOMER-19851 (285 letters) >FitnessBrowser__azobra:AZOBR_RS26995 Length = 303 Score = 139 bits (351), Expect = 6e-38 Identities = 102/286 (35%), Positives = 152/286 (53%), Gaps = 20/286 (6%) Query: 8 IGVIGAGTMGNGIAQVCAVAGLNVTMLDVDDAALKRGMDTIIRNLDRMVAKEKLTASARD 67 IG+IGAG MG+GIAQ AVAG V + + D ++ + NL+ + R Sbjct: 6 IGIIGAGLMGHGIAQAFAVAGHPVDIHEPDPDRRAGIVERVRGNLESLGMDTAAADRVRP 65 Query: 68 AALAKISTGLDYGALQSADMVIEAATENLGLKLKILRQVANCVGKDAIIATNTSSISITQ 127 A + A+ AD+VIEA E+L LK +I + V A++A+NTS I IT+ Sbjct: 66 CASLE-------DAVSRADVVIEAVPEDLVLKQRIFQAVEAAAPPHALLASNTSVIPITR 118 Query: 128 LGAVLDAPECFIGIHFFNPVPLMSLLEVIRGVQTSDATHAATMAFAQKVGKAPITVRNS- 186 + L +G H++NP + L+EVI+ T DA AA + +GK P+ VR Sbjct: 119 IMEPLRDKSRALGTHWWNPPYQIPLVEVIQTADTDDAAVAAMIGLLAAIGKTPVHVRKDV 178 Query: 187 PGFVVNRILCPMINEAIFVLQEGLASAEGIDV------GMRLGCNHPIGPLALADMIGLD 240 PGF+ NR+ + EAI ++Q G+ AE +D G RL +GPL AD++G D Sbjct: 179 PGFIGNRLQHALWREAIALVQNGVCDAETVDAVVKASFGRRLAV---LGPLENADLVGTD 235 Query: 241 TLLSI-MGVLYDEFNDPKYRPALLLKEMVAAGRLGRKTKQGFYSYS 285 L++ VL D P+ P LL+++VA+GRLG K+ GF +++ Sbjct: 236 LTLAVHEHVLPDLDRTPE--PLPLLRDLVASGRLGMKSGAGFRTWT 279 Lambda K H 0.321 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 303 Length adjustment: 26 Effective length of query: 259 Effective length of database: 277 Effective search space: 71743 Effective search space used: 71743 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory