Align Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate AZOBR_RS27070 AZOBR_RS27070 ABC transporter permease
Query= TCDB::Q9HU30 (231 letters) >FitnessBrowser__azobra:AZOBR_RS27070 Length = 220 Score = 121 bits (304), Expect = 1e-32 Identities = 77/217 (35%), Positives = 120/217 (55%), Gaps = 14/217 (6%) Query: 5 LHGFGEQLLAGTWMTLKLSLAAVCVGLLLGLLGAIAKTSKYAALRFLGGTYTTIVRGVPE 64 L G+ L GT +T+ L+ A V +GLLLGL+G +A+ S++A LR++ Y + R P Sbjct: 9 LWGYRWLFLNGTLVTIGLTAAVVVLGLLLGLVGGLAQLSRFAVLRWISWAYIELFRCTPL 68 Query: 65 TLWVLMIYFGTVSGLNALGDLFGKPDLALSPFAAGTLALGLCFGAYATEVFRGALLSIPR 124 + +L Y+ AL L G + + A L L L G++ EV RG ++SI Sbjct: 69 LVQLLWFYY-------ALPMLTG---IQIDAVTASVLTLSLYGGSFYAEVIRGGVVSIEA 118 Query: 125 GHREAGQALGLSPGRIFWRIVLPQIWRVALPGLGNLYLILLKDTALVSLITLDEIMRKAQ 184 G EAG ALG++P ++ RIVLPQ + +P L N +I K+T+LVS++ + +++ + Q Sbjct: 119 GQTEAGLALGMTPAKVMRRIVLPQAVKRMIPPLMNQSIIQFKNTSLVSVVAVPDLLYQGQ 178 Query: 185 VASNATKEPFTFYMTAAAIYLSLTVVIMVALHFLERR 221 VA+ T P Y A IY V++V L + +R Sbjct: 179 VAATDTFRPLEVYTIVALIYF----VVLVPLTAIVKR 211 Lambda K H 0.327 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 220 Length adjustment: 22 Effective length of query: 209 Effective length of database: 198 Effective search space: 41382 Effective search space used: 41382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory