Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate AZOBR_RS29210 AZOBR_RS29210 enoyl-CoA hydratase
Query= SwissProt::Q0AVM1 (260 letters) >FitnessBrowser__azobra:AZOBR_RS29210 Length = 266 Score = 162 bits (409), Expect = 9e-45 Identities = 100/260 (38%), Positives = 145/260 (55%), Gaps = 9/260 (3%) Query: 6 IILEKEEKLAVLYINRPKAMNALNKDTLLE-IKDAVTAVNDDPAVELLIITGSGDKSFVA 64 II E ++ + L INRP+ N ++ ++E + +A+ ++ D ++ I+TG+G SF + Sbjct: 5 IIFENDDGIVTLTINRPETRNPISDPDMIEAMLEALDRIDRDLSIRTAILTGTGT-SFSS 63 Query: 65 GADIAFMQN-------LSAMEAREFGALGQKVFRLIEAMEKPVIAAVNGFALGGGCELAM 117 G ++ M L A R + Q++ EA+E P+IAAVNG A+G GC+LA Sbjct: 64 GGNLKTMGEQGGINDPLPAQTRRNYKFGIQRLPLAFEALEVPIIAAVNGPAIGAGCDLAC 123 Query: 118 CCDFRIAASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIG 177 CD RIAA A F + V +GI PG GG LPR+VG A ++ T D I+A EA G Sbjct: 124 MCDLRIAAERAVFAESFVKVGIVPGDGGAWLLPRVVGFSKACEMALTGDPIDAAEALACG 183 Query: 178 LVNKVVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIEADAFGLCF 237 LV+KVV +ELL E +K+A RI + AVR++K EG +D + + A L Sbjct: 184 LVSKVVPNDELLAEARKLAMRIAANPPHAVRMTKRLLREGRNATLDHLLELSAAMQALAH 243 Query: 238 ATQDQKEGMTAFLEKRKANF 257 AT D KE + A L KR +F Sbjct: 244 ATADHKEAVAALLGKRPPSF 263 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 266 Length adjustment: 25 Effective length of query: 235 Effective length of database: 241 Effective search space: 56635 Effective search space used: 56635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory