Align Solute-binding (Aliphatic amino acid) component of ABC transporter (characterized, see rationale)
to candidate AZOBR_RS29665 AZOBR_RS29665 ABC transporter substrate-binding protein
Query= uniprot:Q1MDE9 (367 letters) >FitnessBrowser__azobra:AZOBR_RS29665 Length = 381 Score = 111 bits (277), Expect = 4e-29 Identities = 102/339 (30%), Positives = 155/339 (45%), Gaps = 23/339 (6%) Query: 7 TATLVASLAFAP---LAHADITIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILGE 63 TA L+++ AP A I IG+ PLTG VAA G+ V NGA+ A + +N GG+LG+ Sbjct: 4 TALLLSAALLAPGVAFAQETIKIGVTQPLTGAVAASGNYVANGARVAEEVVNANGGVLGK 63 Query: 64 KVVLELADDAGEPKQGVSAANK-VVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPTA 122 K+ L + D+ PK+ V++A K +V D + ++G +S + V L E GV MV T+ Sbjct: 64 KIQLIIEDNKSNPKEAVASAEKLIVRDKVPVLMGAWSSTFTLAVMPKLVEYGVPMVVETS 123 Query: 123 TAPDLTKRGLTNVLRTCGRDDQQAEVAAKYVLKNF-----KDKRVAIVNDKGAYGKGLAD 177 ++ +T G V R +A+ A+ L +F K +A+ ND +G+G AD Sbjct: 124 SSTKITTSGNPWVFRIAPTSAMEAKSFAE-KLDHFQPAIQKADFLAVNND---FGRGSAD 179 Query: 178 AFKATLNAGGITEVVNDAITPGDKDFSALTTRIKSEKVDVVYFGGYHPEGGLLARQLHDL 237 F+ L A G+ V + + P D SA + IK D ++ + L+ +Q +L Sbjct: 180 EFRKMLQAKGVKIGVTETMAPEATDLSAQLSSIKQSGGDTLFVTTGVEQITLILKQAAEL 239 Query: 238 -AANATIIGGDGLSNTEFWAIGTDAAGGTIFT------NASDATKSPDSKAAADALAAKN 290 + I G S + A AA G FT A +K D K Sbjct: 240 RLPHRVITNGGSSSPDQLIAQAGAAADGGYFTLFFAPWFPEKAVHPTVAKTFVDGWNKKG 299 Query: 291 IPAEAFT--LNAYAAVEVLKAGIEKAGSAEDAEAVATAL 327 T Y + + I+KAG AE +A+ AL Sbjct: 300 YDFAGLTEGYRGYDGIMTIVEAIKKAGKAE-PQAIRDAL 337 Lambda K H 0.312 0.131 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 381 Length adjustment: 30 Effective length of query: 337 Effective length of database: 351 Effective search space: 118287 Effective search space used: 118287 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory