Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate AZOBR_RS29790 AZOBR_RS29790 3-ketoacyl-ACP reductase
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >FitnessBrowser__azobra:AZOBR_RS29790 Length = 250 Score = 157 bits (397), Expect = 2e-43 Identities = 96/253 (37%), Positives = 138/253 (54%), Gaps = 6/253 (2%) Query: 17 ERLKNKVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEKVEKVAAHWREQGADVVAIK 76 +RL KV L+TGAAQG+G A+ TF + R+ + DI G+ + VA G + I Sbjct: 3 KRLDGKVALITGAAQGLGLAMAETFVREGGRVAVVDINGDAAKAVA---ERLGESAIGIA 59 Query: 77 ADVSRQQDLHAMARLAIELHGRIDVLVNCAGVNVFRDPLQ-MTEEDWHRCFAIDLDGAWY 135 A+V+R D+ +E GR+D+LVN AG P + +TEE++ R FA+++ + Sbjct: 60 ANVTRMADVEMTIAATVEKFGRLDILVNNAGSTHANGPFENVTEEEFDRVFALNVKSIYL 119 Query: 136 GCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRV 195 KAV+ M Q G I+N+ ST PG Y K + +T++L +E AP IRV Sbjct: 120 YSKAVVATMRAQKSGVILNLGSTAGLRPRPGLVWYNATKGAVHNITKSLALELAPDNIRV 179 Query: 196 NAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFI 255 A+AP ET L + G D +R R + P R+GQP +VA A++LASDEA F+ Sbjct: 180 CALAPVATETPLLATFMGG--DTPEKRARMMGIVPLGRLGQPTDVANAALYLASDEAAFL 237 Query: 256 NASCITIDGGRSV 268 + IDGGR V Sbjct: 238 TGVVLEIDGGRCV 250 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 250 Length adjustment: 25 Effective length of query: 247 Effective length of database: 225 Effective search space: 55575 Effective search space used: 55575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory