Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate AZOBR_RS29790 AZOBR_RS29790 3-ketoacyl-ACP reductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >FitnessBrowser__azobra:AZOBR_RS29790 Length = 250 Score = 130 bits (327), Expect = 3e-35 Identities = 88/247 (35%), Positives = 129/247 (52%), Gaps = 9/247 (3%) Query: 16 LKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERVD 75 L GK L+TG G+G + E F R+G V DI G ++ + ERL G A + Sbjct: 5 LDGKVALITGAAQGLGLAMAETFVREGGRVAVVDINGDAAKAVAERL---GESAIGIAAN 61 Query: 76 LTDVASLQAVIARLIKGAGGFDILVNNAANDDRHA-IDEITEAYWDERLSVNLKHIFFCA 134 +T +A ++ IA ++ G DILVNNA + + + +TE +D ++N+K I+ + Sbjct: 62 VTRMADVEMTIAATVEKFGRLDILVNNAGSTHANGPFENVTEEEFDRVFALNVKSIYLYS 121 Query: 135 QAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATC 194 +AVV MRA+ G I+NLGS + LV Y K A+ +T+SLA +L D IR Sbjct: 122 KAVVATMRAQKSGVILNLGSTAGLRPRPGLVWYNATKGAVHNITKSLALELAPDNIRVCA 181 Query: 195 VIPGNVRTPRQLKWY---SPEGEAEIVAAQCLDGRLA-PEDVAAMVLFLASDDARLVTGH 250 + P TP + +PE A ++ L GRL P DVA L+LASD+A +TG Sbjct: 182 LAPVATETPLLATFMGGDTPEKRARMMGIVPL-GRLGQPTDVANAALYLASDEAAFLTGV 240 Query: 251 SYFVDAG 257 +D G Sbjct: 241 VLEIDGG 247 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 250 Length adjustment: 24 Effective length of query: 235 Effective length of database: 226 Effective search space: 53110 Effective search space used: 53110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory