Align 4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase; CHMS dehydrogenase; 2-hydroxy-4-carboxymuconate semialdehyde hemiacetal dehydrogenase; EC 1.1.1.312 (characterized)
to candidate AZOBR_RS29845 AZOBR_RS29845 oxidoreductase
Query= SwissProt::Q9KWL3 (315 letters) >FitnessBrowser__azobra:AZOBR_RS29845 Length = 342 Score = 65.9 bits (159), Expect = 1e-15 Identities = 46/141 (32%), Positives = 67/141 (47%), Gaps = 4/141 (2%) Query: 2 RIALAGAGAFGEKHLDGLKNI-DGVEIVSIISRKAEQAAEVAAKYGAKHSGTDLSEALAR 60 R+ + G G H L ++ D VE+ S AE+ A AA++G D +EA+ Sbjct: 4 RVGVIGLGMAATPHAQSLLDLADRVEVAGCFSPSAERRAAFAARFGLP--AVDRAEAILD 61 Query: 61 DD-VDAVILCTPTQMHAEQAIACMNAGKHVQVEIPLADSWADAEAVMKKSQETGLVCMVG 119 D V AV+L TP HA+ C AGKHV +E PL + A AV++ + GL V Sbjct: 62 DPTVSAVLLLTPPDTHADLVARCAAAGKHVLLEKPLDATPAGCRAVVESMERAGLTLGVM 121 Query: 120 HTRRFNPSHQYIHNKIVAGEL 140 RF + + + + G L Sbjct: 122 LQHRFRAAAERLAELLRTGTL 142 Lambda K H 0.319 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 342 Length adjustment: 28 Effective length of query: 287 Effective length of database: 314 Effective search space: 90118 Effective search space used: 90118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory