Align spermidine/putrescine ABC transporter, permease protein PotC (characterized)
to candidate AZOBR_RS30780 AZOBR_RS30780 spermidine/putrescine ABC transporter permease
Query= CharProtDB::CH_088340 (264 letters) >FitnessBrowser__azobra:AZOBR_RS30780 Length = 264 Score = 102 bits (254), Expect = 8e-27 Identities = 63/228 (27%), Positives = 115/228 (50%), Gaps = 1/228 (0%) Query: 18 LYIPIIILIVNSFNSSR-FGINWQGFTTKWYSLLMNNDSLLQAAQHSLTMAVFSATFATL 76 L PI+++ S N + QGF+ WY+ + + A SL +A SA A L Sbjct: 16 LAAPILVVAGVSVNEKKALTFPPQGFSLAWYAEVFTDPGWRGALITSLVVATLSAALAVL 75 Query: 77 IGSLTAVALYRYRFRGKPFVSGMLFVVMMSPDIVMAISLLVLFMLLGIQLGFWSLLFSHI 136 I A L+R+R + + P ++ A+ L + +G W+++ SH Sbjct: 76 IAFPLAWFLWRWRAPWARAFEVLGMTPFILPPVITALGFLSFWAAVGEYGSPWTVVVSHA 135 Query: 137 TFCLPFVVVTVYSRLKGFDVRMLEAAKDLGASEFTILRKIILPLAMPAVAAGWVLSFTLS 196 F + +VT+ D +EAA +GA + T+LR +++PL P V +G+ +F LS Sbjct: 136 VFFVTLPLVTLSLGFGAVDRSYVEAAATMGADDRTVLRTVVMPLVRPYVISGFAFAFVLS 195 Query: 197 MDDVVVSSFVTGPSYEILPLKIYSMVKVGVSPEVNALATILLVLSLVM 244 +++ +V+ V G + E LP+KI++ ++ G +P + A+ + + L+ V+ Sbjct: 196 LNEYIVAYMVVGFTLETLPIKIFNALRYGYTPTMAAVTVLFVSLTAVV 243 Lambda K H 0.329 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 264 Length adjustment: 25 Effective length of query: 239 Effective length of database: 239 Effective search space: 57121 Effective search space used: 57121 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory