Align Galactofuranose-binding protein YtfQ (characterized)
to candidate AZOBR_RS31215 AZOBR_RS31215 sugar ABC transporter substrate-binding protein
Query= SwissProt::P39325 (318 letters) >FitnessBrowser__azobra:AZOBR_RS31215 Length = 321 Score = 437 bits (1123), Expect = e-127 Identities = 223/320 (69%), Positives = 259/320 (80%), Gaps = 6/320 (1%) Query: 1 MWKRLLIVSAVSAAM-----SSMALAAPLTVGFSQVGSESGWRAAETNVAKSEAEKRGIT 55 M + LI +A +AA+ + A L VGFSQ+GSESGWRAAET AK+EAEKRGI Sbjct: 1 MSRTWLISAAAAAALLIGLGGAQAADKKLVVGFSQIGSESGWRAAETKTAKAEAEKRGID 60 Query: 56 LKIADGQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSID 115 LKI+D QQKQENQIKAVRSFVAQGVDAIFIAPVVATGW+ VLKEAK+A+IPV LLDR I+ Sbjct: 61 LKISDAQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWDSVLKEAKEAKIPVVLLDRQIE 120 Query: 116 VKDKSLYMTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAI 175 +D LYMT VT+D +LEG++ G+WL K+ G CNVVELQGTVG+S AI+RKKGF E + Sbjct: 121 TRDPGLYMTAVTSDTVLEGRVAGEWLAKQTGGT-CNVVELQGTVGSSPAINRKKGFDEVV 179 Query: 176 KNAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAG 235 P +KI+R+QSGDFTR+KGKEVMESFIKAEN GK IC VYAHNDDM +GAIQAIKEAG Sbjct: 180 AKTPGMKIVRTQSGDFTRAKGKEVMESFIKAENGGKGICAVYAHNDDMAVGAIQAIKEAG 239 Query: 236 LKPGKDILTGSIDGVPDIYKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMPEKLTL 295 LKPGKDIL SIDGVPDI+KAM +GEANA+VELTPNMAGPAFDAL +KKDG P K Sbjct: 240 LKPGKDILVVSIDGVPDIFKAMAEGEANATVELTPNMAGPAFDALVAFKKDGKAPPKWIQ 299 Query: 296 TKSTLYLPDTAKEELEKKKN 315 T+S L+ PDTAK E E++K+ Sbjct: 300 TESALFTPDTAKAEYERRKD 319 Lambda K H 0.313 0.130 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 321 Length adjustment: 28 Effective length of query: 290 Effective length of database: 293 Effective search space: 84970 Effective search space used: 84970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory