Align GguB aka ATU2346 aka AGR_C_4262, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate AZOBR_RS31250 AZOBR_RS31250 ABC transporter permease
Query= TCDB::O05177 (398 letters) >FitnessBrowser__azobra:AZOBR_RS31250 Length = 403 Score = 498 bits (1283), Expect = e-146 Identities = 246/389 (63%), Positives = 316/389 (81%), Gaps = 5/389 (1%) Query: 14 ISVGSYIRSNIREYGMLIALVAIMVFFQFYTGGILFRPVNLTNLILQNSFIVIMALGMLL 73 +S+G ++++++REYGML++LVAI++FFQ+ T G L +P+NLTNL+LQNS+IVIMALGMLL Sbjct: 14 VSMGRFVKAHMREYGMLLSLVAIVLFFQYMTDGTLLQPLNLTNLVLQNSYIVIMALGMLL 73 Query: 74 VIVAGHIDLSVGSIVAFVGAIAAILTVQWGMNPFLAALICLVIGGIIGAAQGYWIAYHRI 133 VIVAGHIDLSVGS+VA +GA+AA L V+ ++ L+CL+ G IGA QG+W+AY RI Sbjct: 74 VIVAGHIDLSVGSVVALIGALAATLMVRLHLDFVTTTLLCLLAGAAIGAVQGFWVAYLRI 133 Query: 134 PSFIVTLAGMLVFRGLTLFVLGGKNIGPFPTDFQVISTGFLPDIGGIEGLNT-----TSM 188 PSFIVTLAGMLVFRGL L +L G+++GPFP +FQ +S+GF+PD ++ LN TS+ Sbjct: 134 PSFIVTLAGMLVFRGLCLILLAGQSVGPFPVEFQRLSSGFIPDFLALDALNLGKFHLTSL 193 Query: 189 ILTVLITVALFYLAWRRRVVNVKHGIDVEPFGFFIVQNLLISGAILFLGYQLSTYRGLPN 248 +L + A+ + R R+ I+ EP F+ +N+ ++ ++++G +++YRGLPN Sbjct: 194 LLCAAVAAAMVAMNTRARLRRQSVAIEQEPLPLFVAKNVALAAVLIYVGQLMASYRGLPN 253 Query: 249 VLIVMLVLIALYSFVTRRTTIGRRVYAMGGNEKATKLSGINTERLSFLTFVNMGVLAGLA 308 VLI+M VLIALYSFVTR TT+GRRVYA+GGNEKA KLSGI+T RLSF TFVNMGVLA LA Sbjct: 254 VLIIMSVLIALYSFVTRNTTVGRRVYALGGNEKAAKLSGIDTRRLSFYTFVNMGVLAALA 313 Query: 309 GMIIATRLNSATPKAGVGFELDVIAACFIGGASASGGVGKITGAVIGAFIMGVMNNGMSI 368 G+I A RLN+ATPKAG FELDVIAACFIGGASASGGVG++TGAVIGAFIMGVMNNGMSI Sbjct: 314 GLIFAARLNTATPKAGASFELDVIAACFIGGASASGGVGRVTGAVIGAFIMGVMNNGMSI 373 Query: 369 VGLGIDFQQMVKGLVLLAAVFFDVYNKNK 397 +G+GID+QQ++KG+VLLAAV DVYNKNK Sbjct: 374 LGIGIDWQQVIKGMVLLAAVTIDVYNKNK 402 Lambda K H 0.329 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 403 Length adjustment: 31 Effective length of query: 367 Effective length of database: 372 Effective search space: 136524 Effective search space used: 136524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory