Align TRAP-type periplasmic solute-binding protein (characterized, see rationale)
to candidate AZOBR_RS31400 AZOBR_RS31400 C4-dicarboxylate ABC transporter
Query= uniprot:Q930R1 (334 letters) >FitnessBrowser__azobra:AZOBR_RS31400 Length = 329 Score = 176 bits (446), Expect = 7e-49 Identities = 99/299 (33%), Positives = 172/299 (57%), Gaps = 6/299 (2%) Query: 1 MRKLLLATTAIAFGLSAAAPAFAEFNDRNIRVSNGINEDHPVGNGIKAMQACLDQKSGGK 60 +R LLA A L A P A R+ R ++ D+P +K + L +++GGK Sbjct: 8 IRAALLAACAACTLL--ATPVVA----RDFRSADIHPADYPTVEAVKYVDKLLKERTGGK 61 Query: 61 LKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGIIPALGVFDLPFLFANAQEAYT 120 L + + GALG + + L+ G + + + +PL ++P V LPF+F + + Sbjct: 62 LGVKVYPNGALGTEKDTIEQLKIGGLDMMRINVAPLNNVVPETMVTALPFIFRSTEHMRA 121 Query: 121 VLDGDFGDMMNEKLEAAGLVNLAYWENGFRNLSNSVRPVTKWEDFEGMKVRVMQNNIFLD 180 VLDG GD + +E+ G++ LA++++G R++ ++ +P D +G K+RV Q+++F+ Sbjct: 122 VLDGPIGDEILAAMESQGMIGLAFYDSGSRSMYSAAKPYKTLADMKGAKIRVQQSDLFVA 181 Query: 181 TFQNLGANATPMAFGEVFSALETKAIDAQENPYVTIDTSKFFEVQKYVTETNHAYTPFLF 240 Q LGANATPM FGEV++AL+T +DA EN Y + ++S+ FE KY T T HA P + Sbjct: 182 MIQALGANATPMPFGEVYTALKTGIVDAAENNYPSYESSRHFEAAKYFTLTEHAMAPEVL 241 Query: 241 LFSKPIFDSYTPEEQAALRECAVVGRDEERKVIQDLNKKSLEKIKEAGLEVNTLSAEEQ 299 +FSK +D + ++QAA+R+ A RK+ + +KS + + +AG ++ ++ +++ Sbjct: 242 VFSKVSWDRLSKDDQAAIRKAAKDSVPYMRKLWDEREQKSKDVVVKAGAQIVEVTNKQE 300 Lambda K H 0.317 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 329 Length adjustment: 28 Effective length of query: 306 Effective length of database: 301 Effective search space: 92106 Effective search space used: 92106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory