Align L-fuconate dehydratase; L-rhamnonate dehydratase (EC 4.2.1.68; EC 4.2.1.90) (characterized)
to candidate AZOBR_RS31430 AZOBR_RS31430 galactarate dehydratase
Query= reanno::BFirm:BPHYT_RS34230 (431 letters) >FitnessBrowser__azobra:AZOBR_RS31430 Length = 507 Score = 218 bits (555), Expect = 3e-61 Identities = 146/404 (36%), Positives = 214/404 (52%), Gaps = 28/404 (6%) Query: 5 AQQPTLEGYLRGDGRKGIRNVVAVAYLVECAHHVAREIVTQFR-EPLDAFDDPSAEREPP 63 A++ T +G +R DGR RN + + V C+ AR I QFR + L A+ + Sbjct: 105 AERATFQGIVRPDGRVATRNYIGILTTVNCSATAARMIADQFRGDALAAYPNIDGV---- 160 Query: 64 VHLIGFPGCYPNGYAE------KMLERLTTHPNVGAVLFVSLGCESMNKHYLVDVVRAS- 116 V L GC + + + HPN AVL + LGCE LV+V + Sbjct: 161 VALTHSYGCGMGSQGDAIDALRRTIAGYARHPNFAAVLVLGLGCEVNQIDKLVEVEGLTI 220 Query: 117 GRPVEVLTIQEKGGTRSTIQYGVDWIRGAREQLAAQQKVPMALSELVIGTICGGSDGTSG 176 G ++ L IQE GGT +T++ V+ IR ++ ++ + S L++ CGGSDG SG Sbjct: 221 GDTLQTLAIQESGGTAATVRASVERIRALLPRVNDVKRETVPASHLILALQCGGSDGYSG 280 Query: 177 ITANPAVGRAFDHLIDAGATCIFEETGELVGCEFHMKTRAARPALGDEIVACVAKAARYY 236 ITANPA+G A D LI G T + ET E+ G E + R+ PA+G+ +V + Y Sbjct: 281 ITANPALGHAVDLLIRNGGTAVLSETPEVYGAEHLLTRRSVNPAVGETLVERIRWWEDYT 340 Query: 237 SILG---HGSFAVGNADGGLTTQEEKSLGAYAKSGASPIVGIIKPGDIPPTG-GLYLLDV 292 S G + + + GN GGLTT EKSLGA AK+G + +V +++ + P TG GL +D Sbjct: 341 SRTGGEMNNNPSPGNKKGGLTTILEKSLGAVAKAGTTNLVEVVRYAE-PITGPGLVFMDT 399 Query: 293 VPDGEPRFGFPNISDNAEIGELIACGAHVILFTTGRGSVVGSAISPVIKVCANPATYRNL 352 G+ +S + +A GA+V+ FTTGRGSV G +P +K+ N A +R + Sbjct: 400 P-------GYDPVSATGQ----VAGGANVLCFTTGRGSVFGCKPTPSLKLATNTALFRKM 448 Query: 353 SGDMDVDAGRILEGRGTLDEVGREVFEQTVAVSRGAASKSETLG 396 DMD+D G I G T++EVGR +F+ + + G +KSE LG Sbjct: 449 PDDMDIDCGPIATGDATIEEVGRTIFQLILDTASGKKTKSEELG 492 Lambda K H 0.318 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 657 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 507 Length adjustment: 33 Effective length of query: 398 Effective length of database: 474 Effective search space: 188652 Effective search space used: 188652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory