Align Citrate uptake transporter, membrane subunit, component of Pmf-dependent citrate uptake porter, TctABC (characterized)
to candidate AZOBR_RS31455 AZOBR_RS31455 C4-dicarboxylate ABC transporter
Query= TCDB::S5XH28 (188 letters) >FitnessBrowser__azobra:AZOBR_RS31455 Length = 162 Score = 61.2 bits (147), Expect = 9e-15 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 7/128 (5%) Query: 55 VLNMDVGNAAFPGPRFFPTILGIAGLLVAVALTIQTIKYPMHPENESGRSWKFHSDYVSL 114 +L VG A GP FP + I+G LV V L++ + + G D ++ Sbjct: 30 MLTPSVGRAVV-GPALFPYL--ISGGLVLVGLSLLREAFAGAVAHAEG----LELDLWAV 82 Query: 115 AWAIGGFFAFAVLLPYLGWVLAGSLLFWTMTRAFGSKRPGFDVLVSLMMSSVVYLAFDVG 174 A G +LL LGW+ + ++LF ++RAFG +R ++ + L +++ ++AF+ G Sbjct: 83 ALVAAGLAVQFLLLDTLGWIPSTTILFAAVSRAFGGRRLMVNLAIGLALAAFTFVAFNYG 142 Query: 175 LGLNLPSG 182 LGLNLP G Sbjct: 143 LGLNLPEG 150 Lambda K H 0.324 0.143 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 78 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 188 Length of database: 162 Length adjustment: 19 Effective length of query: 169 Effective length of database: 143 Effective search space: 24167 Effective search space used: 24167 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory