Align succinate-semialdehyde dehydrogenase [NAD(P)+]; EC 1.2.1.16 (characterized)
to candidate AZOBR_RS32240 AZOBR_RS32240 acetaldehyde dehydrogenase
Query= CharProtDB::CH_007085 (453 letters) >FitnessBrowser__azobra:AZOBR_RS32240 Length = 886 Score = 304 bits (778), Expect = 9e-87 Identities = 162/433 (37%), Positives = 251/433 (57%), Gaps = 8/433 (1%) Query: 7 IKELIEKAKVAQKKLEAYSQEQVDVLVKALGKVVYDNAEMFAKEAVEETEMGVYEDKVAK 66 + +L+ + + AQK + QE VD + ++ + AK AV ET MGV EDKV K Sbjct: 9 LNDLVLRVREAQKVYAGFPQETVDRIFRSAALAAANARIPLAKLAVAETRMGVMEDKVVK 68 Query: 67 CHLKSGAIWNHIKDKKTVGIIKEEPERALVYVAKPKGVVAATTPITNPVVTPMCNAMAAI 126 H S I+N KD+KT GI++E+PE ++ +A+P G++ A P TNP T + A+ ++ Sbjct: 69 NHFASEYIYNKYKDEKTCGILEEDPEYGIMTIAEPVGLICAIVPTTNPTSTAIFKALISL 128 Query: 127 KGRNTIIVAPHPKAKKVSAHTVELMNAELKKLGAPENIIQIVEAPSREAAKELMESADV- 185 K RN I+ +PHP+A+K + ++ + GAP +II ++ PS + + +M D+ Sbjct: 129 KTRNGIVFSPHPRARKATCEAARIVLQAAVEAGAPADIIGWIDEPSVDLSNAVMHHPDIN 188 Query: 186 -VIATGGAGRVKAAYSSGRPAYGVGPGNSQVIVDKGYDYNKAAQDIITGRKYDNGIICSS 244 ++ATGG G VKAAYSSG+PA GVG GN+ ++D+ D +A I+ + +DNG++C+S Sbjct: 189 LILATGGPGMVKAAYSSGKPAIGVGAGNTPAVIDEFADIKRAVASILMSKTFDNGVVCAS 248 Query: 245 EQSVIAPAEDYDKVIAAFVENGAFYVEDEETVEKFRSTLFKDGKINSKIIGKSVQIIADL 304 EQS I YD V F +G + + + R L K+G +N+ I+G+S IA + Sbjct: 249 EQSAIVVDAVYDAVRDRFAHHGGHILSGTD-ADAVRKVLLKNGALNADIVGQSAGAIAAM 307 Query: 305 AGVKVPEGTKVIVLKGKGAGEKDVLCKEKMCPVLVALKYDTFEEAVEIAMANYMYEGAGH 364 AGV VP TKV++ + + E + EK+ P L + F +A + A A G GH Sbjct: 308 AGVSVPANTKVLIAEVEAVTEDEPFAHEKLSPTLALYRARDFMDACDKAAALVALGGIGH 367 Query: 365 TAGIHSDND---ENIRYAGTVLPISRLVVNQPATTA--GGSFNNGFNPTTTLGCGSWGRN 419 T+ +++D D E IR+ G + +R+++N P++ G +N P+ TLGCGSWG N Sbjct: 368 TSALYTDQDQQPERIRHFGQAMKTARILINTPSSQGGIGDLYNFRLAPSLTLGCGSWGGN 427 Query: 420 SISENLTYEHLIN 432 SISEN+ +HLIN Sbjct: 428 SISENVGPQHLIN 440 Lambda K H 0.313 0.131 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 848 Number of extensions: 44 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 886 Length adjustment: 38 Effective length of query: 415 Effective length of database: 848 Effective search space: 351920 Effective search space used: 351920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory