Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate AZOBR_RS32275 AZOBR_RS32275 branched-chain amino acid ABC transporter permease
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__azobra:AZOBR_RS32275 Length = 290 Score = 186 bits (472), Expect = 6e-52 Identities = 108/293 (36%), Positives = 159/293 (54%), Gaps = 12/293 (4%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSL 60 M+ F Q L NGL +G Y L A+G T+++G++ ++NFAHGE YM+G G Sbjct: 1 MDLFPQFLANGLVMGVFYALSALGLTLIFGLMRVVNFAHGEFYMLGG--------VSGWF 52 Query: 61 GITWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQI 120 ++ L L+ F A GW V+R +R ++ IG+SIFL N + Sbjct: 53 VTNYLGLDFFSGLIVVAAFMAAVGWLVDRFLIERVRGQGEEPGILLTIGLSIFLVNGTLL 112 Query: 121 LQG-ARSKPLQPILPGNLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSLGRAQRA 179 L G A K + G L G ++V+ +RL + + IAL+ G LI RT LG A RA Sbjct: 113 LVGPAPMKVAGAVAEGPLFF--GPIAVTKLRLLAVAVGIALIVGAHLLIRRTRLGAAMRA 170 Query: 180 CEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTAA 239 QD A L G+ V + TF +G LAA++GM++ IY +G L +K+F Sbjct: 171 TFQDPMAASLAGIRTGHVYAATFALGCTLAALSGMLLASIYSA-QASVGGLISLKSFVVV 229 Query: 240 VLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGL 292 +LGG+GS GA+ GG+++G+ EA W GY+ DV F +++L+L+FRP GL Sbjct: 230 ILGGMGSFAGAIAGGLLLGVAEAMWGGYVSMGMVDVIGFVLVILILLFRPQGL 282 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 290 Length adjustment: 26 Effective length of query: 275 Effective length of database: 264 Effective search space: 72600 Effective search space used: 72600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory