Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate AZOBR_RS32405 AZOBR_RS32405 ABC transporter
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__azobra:AZOBR_RS32405 Length = 255 Score = 197 bits (501), Expect = 2e-55 Identities = 117/266 (43%), Positives = 167/266 (62%), Gaps = 17/266 (6%) Query: 12 DTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMI 71 +TLL ++ L+ +FGGL+A++D S +G++ LIGPNGAGKTT+FN ITGF P+ G + Sbjct: 3 NTLLSIQGLTRRFGGLLAVSDVSATIAKGELVGLIGPNGAGKTTLFNLITGFTPPSDGTV 62 Query: 72 TFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKASGYT 131 TF+ Q + R P ++I + + RTFQN+R+F +TV +N+ V ++ Sbjct: 63 TFD----GQDVTGRKP-WQIARMG-MGRTFQNLRVFPNMTVFDNVSVGAVGAFGQSPW-- 114 Query: 132 ILGLIGVGPYKREAAEAIELARFW--LEKADLIDRADDPAGDLPYGAQRRLEIARAMCTG 189 LI G + R +E R W LE+ L +A D A +L YG ++ LEIARA+ T Sbjct: 115 -RALINGGAHSRAVSE-----RSWEALERVGLTAQAGDIAANLSYGKRKYLEIARALATA 168 Query: 190 PELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQ 249 P LL LDEPAAGLN E+A L ++ + A G ++LL+EHDM +VM V+VL G+ Sbjct: 169 PRLLILDEPAAGLNDTETAELADFIRRLHA-GGVTVLLVEHDMGLVMGSCSRVIVLASGR 227 Query: 250 KISDGTPDHVKNDPRVIAAYLGVEDE 275 KI+DGTP+ V+ DP V+ AYLGVED+ Sbjct: 228 KIADGTPEAVQRDPAVLEAYLGVEDD 253 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 255 Length adjustment: 25 Effective length of query: 267 Effective length of database: 230 Effective search space: 61410 Effective search space used: 61410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory