Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate AZOBR_RS32415 AZOBR_RS32415 branched-chain amino acid ABC transporter permease
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__azobra:AZOBR_RS32415 Length = 305 Score = 198 bits (504), Expect = 1e-55 Identities = 119/305 (39%), Positives = 180/305 (59%), Gaps = 24/305 (7%) Query: 3 YFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSLGI 62 +FLQQ+INGLS+G +Y L+AIG+T+++G++ ++NFAHGE+Y IGAFV L+ A+ + Sbjct: 6 FFLQQVINGLSIGCVYALMAIGFTLIFGVLNVVNFAHGEVYTIGAFVGLMVITAMAPPLL 65 Query: 63 TWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRS----------SPRLAPLISAIGMSI 112 VPL L V AV G +ERIA+RP R + R A L+S++ +SI Sbjct: 66 AVVPLVLAV--------GAVSGVGLERIAFRPFRRFTDEASQKSRAMREATLLSSLAVSI 117 Query: 113 FLQNYVQILQGARSKPLQPILPGNLTLMDGAVSVSYVRLATIVI--TIALMYGFTQ-LIT 169 + + + G +Q I G L A+ V ++VI T A+M G Q L+ Sbjct: 118 MTREIMMHIFGG---DMQGIPSGYLLQQPVAIGPIMVASGSLVIFATSAVMLGALQFLLY 174 Query: 170 RTSLGRAQRACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGF 229 RT G RA ++ A +G+N DR I TF +G+ L A AG++V L G I ++GF Sbjct: 175 RTQTGLGIRAVSNNQLGARYVGINTDRTIVTTFAVGSMLGATAGILVGLYDGAISPHMGF 234 Query: 230 LAGVKAFTAAVLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRP 289 GVKAF A V+GG+ S+PGA+ +++G+ E+ + ++ S WKD+ T+++LV+ L+F P Sbjct: 235 APGVKAFVAMVMGGLSSIPGAVACALLLGVSESIATEFLSSGWKDLITYSLLVITLVFFP 294 Query: 290 TGLLG 294 GL G Sbjct: 295 QGLFG 299 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 305 Length adjustment: 27 Effective length of query: 274 Effective length of database: 278 Effective search space: 76172 Effective search space used: 76172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory