Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate Ac3H11_3327 Glutamine transport ATP-binding protein GlnQ (TC 3.A.1.3.2)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_3327 Length = 249 Score = 216 bits (550), Expect = 4e-61 Identities = 115/239 (48%), Positives = 156/239 (65%), Gaps = 11/239 (4%) Query: 11 KRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEELKLV 70 K +G+H+VLK VS G+V IIG+SGSGKST LR IN LE +G I + E + Sbjct: 17 KSFGAHQVLKDVSTTFNTGEVTVIIGASGSGKSTLLRAINRLEPHDSGTITIGGEPV--- 73 Query: 71 ANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKTEAREKA 130 D LQ+ RS + MVFQ FNL+ HM+ ++N+ AP + +T+A +A Sbjct: 74 --------GDDQHLLQKQRSEVGMVFQQFNLFGHMSVLDNVTLAPRRIRHTPRTQANAQA 125 Query: 131 EHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPELVGDVLK 190 L +VG+ YP +SGG+QQRVAIARALAM+P+VMLFDEPTSALDPE+V +VL Sbjct: 126 LALLTRVGMQDHAHKYPWQLSGGQQQRVAIARALAMQPKVMLFDEPTSALDPEMVQEVLD 185 Query: 191 VMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSERLQQFL 249 VM+ LA+ G TM+VVTHEMGFAREVS++++F +G + P E NP ++R++ F+ Sbjct: 186 VMRELARGGMTMIVVTHEMGFAREVSDRVMFFDQGRIAHDAPPAEFFNNPANDRIRAFI 244 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 249 Length adjustment: 24 Effective length of query: 230 Effective length of database: 225 Effective search space: 51750 Effective search space used: 51750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory