Align xylono-1,5-lactonase (EC 3.1.1.110) (characterized)
to candidate BPHYT_RS16915 BPHYT_RS16915 gluconolaconase
Query= metacyc::MONOMER-20628 (289 letters) >FitnessBrowser__BFirm:BPHYT_RS16915 Length = 300 Score = 152 bits (383), Expect = 1e-41 Identities = 100/281 (35%), Positives = 137/281 (48%), Gaps = 10/281 (3%) Query: 10 DLKATLGEGPIWHGDT--LWFVDIKQRKIHNYHPATGERFSFDAPDQVTFLAPIVGATGF 67 D K TLGEG W T ++ DI+ ++ Y P S+ P+++ A Sbjct: 15 DTKCTLGEGATWCAQTGHFYWTDIEGARLWRYDPRDCSNMSWHMPERLATFALCADPRYL 74 Query: 68 VVGLKTGIHRFHPATGFSLLLEVEDAALNNRPNDATVDAQGRLWFGTMHDGEENNS-GSL 126 ++GL T + F ATG + + +A LN R ND D QGR FGT +G + G Sbjct: 75 LLGLATHLAFFELATGETRRIIDVEAGLNTRVNDGRCDRQGRFVFGTKDEGAPLQAIGGF 134 Query: 127 YRM--DLTGVARMDRDICITNGPCVSPDGKTFYHTDTLEKTIYAFDLAEDGLLSNKRVFV 184 YR+ DL+ I+N SPDG T Y+ D+ + I A D DG ++N R+F Sbjct: 135 YRLGHDLSLERLPLPAPAISNSIAFSPDGATMYYCDSPTREIRACDYRADGSIANDRLFT 194 Query: 185 QF--ALGDDVYPDGSVVDSEGYLWTALWGGFGAVRFSPQGDAVTRIELPAPNVTKPCFGG 242 + A G+ PDGS VD +G LW A WGG VR+ P G R+++P + GG Sbjct: 195 RLTDATGE---PDGSTVDRDGGLWNAQWGGRRVVRYGPDGMETERVDVPTAQPSCVALGG 251 Query: 243 PDLKTLYFTTARKGLSDETLAQYPLAGGVFAVPVDVAGQPQ 283 L TLY T+AR L LA P AGGVF + G P+ Sbjct: 252 TQLDTLYITSARCDLDAAALANDPHAGGVFIATLGRRGLPE 292 Lambda K H 0.321 0.139 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 300 Length adjustment: 26 Effective length of query: 263 Effective length of database: 274 Effective search space: 72062 Effective search space used: 72062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory