Align L-asparaginase subunit (EC 3.5.1.38) (characterized)
to candidate BWI76_RS11360 BWI76_RS11360 L-asparaginase
Query= metacyc::MONOMER-13049 (346 letters) >FitnessBrowser__Koxy:BWI76_RS11360 Length = 347 Score = 506 bits (1302), Expect = e-148 Identities = 255/345 (73%), Positives = 293/345 (84%) Query: 2 FNALFVVVFVCFSSLANAAENLPNIVILATGGTIAGSAAANTQTTGYKAGALGVETLIQA 61 F AL + + S+ A + LP+IVILATGGTIAGSAA+NTQTTGYKAGA+GV+TLI A Sbjct: 3 FRALLAITLLTISAFAFSDTRLPHIVILATGGTIAGSAASNTQTTGYKAGAIGVQTLINA 62 Query: 62 VPELKTLANIKGEQVASIGSENMTSDVLLTLSKRVNELLARSDVDGVVITHGTDTLDESP 121 VPE+ +A + GEQVA+IGSENMTSD++L LSKRVNELLAR DVDGVVITHGTDTLDE+P Sbjct: 63 VPEMSKVARVDGEQVANIGSENMTSDIILKLSKRVNELLARDDVDGVVITHGTDTLDETP 122 Query: 122 YFLNLTVKSDKPVVFVAAMRPATAISADGPMNLYGAVKVAADKNSRGRGVLVVLNDRIGS 181 YFLNLTVKS+KPVVF AAMRPATAISADGPMNL AV VAAD ++GRGV+VVLNDRIG+ Sbjct: 123 YFLNLTVKSNKPVVFTAAMRPATAISADGPMNLLEAVTVAADPQAKGRGVMVVLNDRIGA 182 Query: 182 ARFISKTNASTLDTFKAPEEGYLGVIIGDKIYYQTRLDKVHTTRSVFDVTNVDKLPAVDI 241 ARF++KTNA+TLDTFKAPEEGYLGVI+ K ++TR+DK+HT RSVFDV ++ LP V I Sbjct: 183 ARFVTKTNATTLDTFKAPEEGYLGVIVSGKPQFETRVDKIHTVRSVFDVRQLNALPKVVI 242 Query: 242 IYGYQDDPEYMYDASIKHGVKGIVYAGMGAGSVSKRGDAGIRKAESKGIVVVRSSRTGSG 301 IYGYQDDPEYMYDA+I H V GI+YAG GAGSVS R AGI KAE GIVVVR+SRTGSG Sbjct: 243 IYGYQDDPEYMYDAAIAHHVDGIIYAGTGAGSVSVRSAAGIEKAEKAGIVVVRASRTGSG 302 Query: 302 IVPPDAGQPGLVADSLSPAKSRILLMLALTKTTNPAVIQDYFHAY 346 +VP D GQPGLV+DSL+PAK+RILLM ALT+T NP VIQ YFH Y Sbjct: 303 VVPVDDGQPGLVSDSLNPAKARILLMTALTQTKNPQVIQQYFHTY 347 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 347 Length adjustment: 29 Effective length of query: 317 Effective length of database: 318 Effective search space: 100806 Effective search space used: 100806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate BWI76_RS11360 BWI76_RS11360 (L-asparaginase)
to HMM TIGR00520 (L-asparaginase, type II (EC 3.5.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00520.hmm # target sequence database: /tmp/gapView.18372.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00520 [M=352] Accession: TIGR00520 Description: asnASE_II: L-asparaginase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-138 446.1 4.3 4.3e-138 445.9 4.3 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS11360 BWI76_RS11360 L-asparaginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS11360 BWI76_RS11360 L-asparaginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 445.9 4.3 4.3e-138 4.3e-138 7 352 .] 7 347 .] 1 347 [] 0.97 Alignments for each domain: == domain 1 score: 445.9 bits; conditional E-value: 4.3e-138 TIGR00520 7 aalaavvlkvsaakaksLPnikilatGGtiagkgqssastaeYkvgklgvedLieavPelkeianiegeqi 77 a++++++++ a ++ LP+i ilatGGtiag+++s+++t++Yk+g +gv++Li+avPe++++a+++geq+ lcl|FitnessBrowser__Koxy:BWI76_RS11360 7 LAITLLTISAFAFSDTRLPHIVILATGGTIAGSAASNTQTTGYKAGAIGVQTLINAVPEMSKVARVDGEQV 77 5677788888888999******************************************************* PP TIGR00520 78 vnvgsqdlneevllklakrisealasddvdGivithGtDtleetayfldltvksdkPvvlvGamRpatsvs 148 +n+gs+++ +++lkl kr++e la ddvdG+vithGtDtl+et yfl+ltvks+kPvv+ amRpat++s lcl|FitnessBrowser__Koxy:BWI76_RS11360 78 ANIGSENMTSDIILKLSKRVNELLARDDVDGVVITHGTDTLDETPYFLNLTVKSNKPVVFTAAMRPATAIS 148 *********************************************************************** PP TIGR00520 149 aDGplnLYnavsvaadeksagrGvlvvlndrilsarevtktnttsldtfkseeqGalGyiandkieyerep 219 aDGp+nL +av+vaad++++grGv+vvlndri ar vtktn+t+ldtfk+ e+G+lG i+ +k ++e+++ lcl|FitnessBrowser__Koxy:BWI76_RS11360 149 ADGPMNLLEAVTVAADPQAKGRGVMVVLNDRIGAARFVTKTNATTLDTFKAPEEGYLGVIVSGKPQFETRV 219 *********************************************************************** PP TIGR00520 220 vkkhtletefdvskldeplPkvdiiYayqnlpeelvkavvdagakGivlagvGnGslsaaalkvleeaake 290 k ht+ + fdv++l+ lPkv iiY+yq+ pe++ +a++ ++ +Gi+ ag+G+Gs+s e+a k lcl|FitnessBrowser__Koxy:BWI76_RS11360 220 DKIHTVRSVFDVRQLNA-LPKVVIIYGYQDDPEYMYDAAIAHHVDGIIYAGTGAGSVSVRSAAGIEKAEKA 289 *****************.***************************************************** PP TIGR00520 291 svvivrssRvadGvvtkdaevddkealiasgtLnPqkaRvLLqLaLtktkdlekiqevfeey 352 ++v+vr+sR+ +Gvv+ vdd++ + s++LnP kaR+LL+ aLt+tk+++ iq++f+ y lcl|FitnessBrowser__Koxy:BWI76_RS11360 290 GIVVVRASRTGSGVVP----VDDGQPGLVSDSLNPAKARILLMTALTQTKNPQVIQQYFHTY 347 ****************....556667789******************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (352 nodes) Target sequences: 1 (347 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.80 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory