Align Acetolactate synthase small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase small subunit; AHAS; ALS (uncharacterized)
to candidate CA265_RS15810 CA265_RS15810 acetolactate synthase small subunit
Query= curated2:P37252 (172 letters) >FitnessBrowser__Pedo557:CA265_RS15810 Length = 212 Score = 101 bits (251), Expect = 9e-27 Identities = 58/154 (37%), Positives = 89/154 (57%), Gaps = 2/154 (1%) Query: 5 ITLTVVNRSGVLNRITGLFTKRHYNIESITVGHTETAGVSRITFVVHVEGENDVEQLTKQ 64 IT+ NR G+LNRI +F+KR NIES+ +E G+ R V+H EG V +L +Q Sbjct: 24 ITVYAENRIGLLNRIAIIFSKRKINIESLNTSPSEIDGIHRFNIVIH-EGYEVVRKLARQ 82 Query: 65 LNKQIDVLKVTDITNQSIVQRELALIKV-VSAPSTRTEINGIIEPFRASVVDVSRDSIVV 123 + KQI+VLKV TN+ I+ +ELAL KV + + + ++ + AS V + +D V Sbjct: 83 IEKQIEVLKVYFNTNEEIIWQELALYKVSTDEIAEKVTVERLLRQYGASAVVIRKDYTVF 142 Query: 124 QVTGESNKIEALIELLKPYGIKEIARTGTTAFAR 157 VTG + +AL++ L+PY + E R+ A + Sbjct: 143 AVTGHREETDALVKALEPYELIEFVRSARVAIIK 176 Lambda K H 0.315 0.131 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 78 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 172 Length of database: 212 Length adjustment: 20 Effective length of query: 152 Effective length of database: 192 Effective search space: 29184 Effective search space used: 29184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 44 (21.6 bits)
Align candidate CA265_RS15810 CA265_RS15810 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.1049.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.1049.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.