Align imidazole glycerol-phosphate synthase (subunit 1/2) (EC 4.3.2.10) (characterized)
to candidate CA265_RS19265 CA265_RS19265 imidazole glycerol phosphate synthase subunit HisH
Query= BRENDA::Q5NMD4 (213 letters) >FitnessBrowser__Pedo557:CA265_RS19265 Length = 207 Score = 146 bits (368), Expect = 3e-40 Identities = 92/201 (45%), Positives = 118/201 (58%), Gaps = 17/201 (8%) Query: 17 GNLRSVANALLASGLARENLVVTANPDEVLQADRVVLPGVGAFASCMQALKAIPDMVPAL 76 GN +SV N + G +++ +P+++LQA +V+LPGVG+F M+ L V AL Sbjct: 14 GNTKSVVNMINRLG---GEVIIANSPEDLLQAKKVILPGVGSFDVGMKELNE-HGWVEAL 69 Query: 77 EKAVLEKGRPFLGICVGMQLLADQGEEYGVHQGLGWIKGKVTPL--RPNDPSCKVPHMGW 134 LEK P LGIC+GMQ D+ EE GV GLGWI GK+ +P +P KVPHMGW Sbjct: 70 NIVALEKKIPVLGICLGMQFFFDESEE-GVLPGLGWIPGKLIKFVSQPENP-IKVPHMGW 127 Query: 135 NQI------GLTTDSHPLLRAGEAYFLHSYAFVPEDESTLLATTEHGGLVTAAVGRDNIM 188 N I GL LR YF+HSY V ED + ++AT HG VTA+V +DNI Sbjct: 128 NAIKVYKSNGLFPIQDEELRY---YFVHSYHAVCEDANHVVATAYHGSDVTASVQKDNIY 184 Query: 189 GVQFHPEKSQSYGLEFLSRFL 209 G QFHPEKS +G+E L FL Sbjct: 185 GFQFHPEKSHRFGMELLKNFL 205 Lambda K H 0.318 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 207 Length adjustment: 21 Effective length of query: 192 Effective length of database: 186 Effective search space: 35712 Effective search space used: 35712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate CA265_RS19265 CA265_RS19265 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.10045.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.10045.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.