Align methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate Echvi_0160 Echvi_0160 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta)
Query= BRENDA::Q9LDD8 (587 letters) >FitnessBrowser__Cola:Echvi_0160 Length = 527 Score = 251 bits (642), Expect = 4e-71 Identities = 165/511 (32%), Positives = 263/511 (51%), Gaps = 42/511 (8%) Query: 72 LSELRSHIKKVLAGGGEEAVKRNRSRNKLLPRERIDRLLDPGSSFLELSQLAGHE----- 126 L L+ ++ L GGG++ + + KL RERI L+D G+ F E+ + H Sbjct: 18 LELLKKKNEEALMGGGQQRIATQHEKGKLTARERIHLLIDEGT-FQEIDKFKMHRCKDFG 76 Query: 127 LYEEPLPSGGIITGIGPIHGRICMFMANDPTVKGGTYYPITIKKHLRAQEIAARCRLPCI 186 L +E G++TG G ++GR+ + D TV GG+ +K + ++A + P I Sbjct: 77 LDKEYYLGDGVVTGYGEVNGRLVYVYSQDFTVFGGSLSETHAEKICKIMDMAMKNGAPVI 136 Query: 187 YLVDSGGAYLPKQAEVFPDKENFGRVFYNESVMSSDGIPQIAIVLGSCTAGGAYIPAMAD 246 L DSGGA + + + +FY + +S IPQ++ ++G C G Y PA+ D Sbjct: 137 GLNDSGGARIQEGVNSLG---GYADIFYRNT-RASGVIPQLSAIMGPCAGGAVYSPAITD 192 Query: 247 ESVMVKGNGTIFLAGPPLVKAATGEEVSAEDLGGATVHCTVSGVSDYFAQDELHGLAIGR 306 +MV+ +F+ GP +VK T E VS+E+LGGA+ H T SGV+ + Q+E+ + Sbjct: 193 FILMVEETSYMFVTGPNVVKTVTQEHVSSEELGGASTHSTKSGVTHFACQNEVECI---- 248 Query: 307 NIVKNLHMAAKQGMEGTFGSKNLVYKEPLYDINE------LRSIAPVDHKQQFDVRSIIA 360 +K++ Q E S YD+ E L ++ P + +D+R ++ Sbjct: 249 KTIKDILSYIPQNCEDDAPSYP-------YDMLEDESRPVLDTMVPENPNHPYDMREVVR 301 Query: 361 RIVDGSEFDEFKKQYGTTLVTGFARIYGQTVGIIGNN-----GILFNESALKGAHFIELC 415 IVD + F E + + +V GFARI G+++G++GN G+L N++++K A F+ C Sbjct: 302 GIVDEASFLEVHQNFADNMVVGFARIAGRSIGVVGNQPQSLAGVLDNDASIKAARFVRFC 361 Query: 416 SQRKIPLVFLQNITGFMVGSRAEANGIAKAGAKMVMAVSCAKVPKITIITGASFGAGNYA 475 +PL+ L ++ GF+ G+ E NGI GAK++ A S A VP+IT+IT ++G Sbjct: 362 DCFNVPLLVLVDVPGFLPGTDQEWNGIITNGAKLLYAFSEATVPRITVITRKAYGGAYDV 421 Query: 476 MCGRAYSPDFMFIWPNARIGIMGGAQAAGVLTQIERATKKRQGIKWTEEEEEAFKKKTVD 535 M + D F WP A I +MG AA ++ + E A E+ EA ++ +D Sbjct: 422 MNSKHIGADLNFAWPTAEIAVMGAKGAAEIIFKKEIA---------QAEDSEAKLQEKID 472 Query: 536 AYERE-ANPYYSTARLWDDGVIDPCDTRKVL 565 Y R+ ANPY + R + D VI P TRK L Sbjct: 473 QYTRKFANPYKAAHRGYIDEVILPSQTRKKL 503 Lambda K H 0.320 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 760 Number of extensions: 46 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 587 Length of database: 527 Length adjustment: 36 Effective length of query: 551 Effective length of database: 491 Effective search space: 270541 Effective search space used: 270541 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory