Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate Echvi_1095 Echvi_1095 nitrate transport ATP-binding subunits C and D
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__Cola:Echvi_1095 Length = 272 Score = 135 bits (339), Expect = 1e-36 Identities = 87/235 (37%), Positives = 130/235 (55%), Gaps = 19/235 (8%) Query: 23 KEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMGLSGSGKSTLVRHFNRLI 82 K+ E++ ++ K G V ++DL+LSI GE I+G SG GKSTL+ L Sbjct: 16 KDQPEMLVCDQLKKVYPTPKGDYVVLDDLNLSIRKGEFVSIIGHSGCGKSTLLTMIAGLN 75 Query: 83 DPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLLPHKSVLDNVAYGLKV----- 137 D + G I VDG +++ D ++VFQS LLP S LDNV G+K Sbjct: 76 DISGGKIKVDGTPVIEAGPDR---------AVVFQSPSLLPWLSALDNVMIGVKQVFPHA 126 Query: 138 -RGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALAADTDIILMDEAF 196 R + + +C ++++ VGL +K H LS GM+QRVG+ARA A ++L+DE F Sbjct: 127 SRAQKQDICK----YYLDKVGLGADFDKKAHSLSQGMQQRVGIARAFALKPKLLLLDEPF 182 Query: 197 SALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKDGKLIQVG 251 LD L R E+QD LLE+ + T V ITHD+DE++ + +R+ ++ G ++G Sbjct: 183 GMLDSLTRGELQDVLLEIWQREKITAVAITHDVDESIFLADRVIMMTSGPYAKIG 237 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 272 Length adjustment: 25 Effective length of query: 251 Effective length of database: 247 Effective search space: 61997 Effective search space used: 61997 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory