Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate Echvi_1582 Echvi_1582 ABC-type antimicrobial peptide transport system, ATPase component
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__Cola:Echvi_1582 Length = 225 Score = 126 bits (317), Expect = 3e-34 Identities = 91/238 (38%), Positives = 134/238 (56%), Gaps = 29/238 (12%) Query: 15 LLEIRDLHKQYGP----LEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGG 70 +L I ++ K Y L VL+ ++L+++ G+ + ++G SGSGKTTLL L+ G Sbjct: 3 ILSIENVSKIYQSGSRTLTVLEDINLSVKAGDSIAIVGPSGSGKTTLLGLCAGLDSASSG 62 Query: 71 QILLDGESI-GYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGL-LK 128 + L+G + G E VR E G FQ F L P LTAL+NV + L LK Sbjct: 63 SVALNGHRLEGLSEDQRAAVRSQE---------IGFIFQNFQLLPTLTALENVMVPLELK 113 Query: 129 VKKLHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVT 188 +K K +A L L++VGL +R HYP QLSGG+QQRV+IARA A P ++ DE T Sbjct: 114 KRKDAKQKATEL----LQQVGLGDRMTHYPTQLSGGEQQRVSIARAFANEPKILFADEPT 169 Query: 189 SALDPELVGEVLSVI-----KGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQ 241 LD E GE++ + K L G T++LVTH+ A + +++I+ + G+I+E+ Sbjct: 170 GNLDTE-TGELIETLIFDLNKAL---GTTLILVTHDTDLAAK-TNRIIHIKGGKIQEE 222 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 225 Length adjustment: 24 Effective length of query: 241 Effective length of database: 201 Effective search space: 48441 Effective search space used: 48441 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory