GapMind for catabolism of small carbon sources

 

Alignments for a candidate for lacB' in Echinicola vietnamensis KMM 6221, DSM 17526

Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate Echvi_1841 Echvi_1841 Cytochrome c551/c552

Query= reanno::Pedo557:CA265_RS15360
         (127 letters)



>FitnessBrowser__Cola:Echvi_1841
          Length = 141

 Score =  100 bits (249), Expect = 8e-27
 Identities = 49/113 (43%), Positives = 69/113 (61%), Gaps = 4/113 (3%)

Query: 19  SKADLSREKTVVATATMTKHAAFQSNP----GEKLINKSDCLGCHNKTNKIIGPAYVEIA 74
           S+   S  ++      M+    ++ NP    G  L+ +SDC  CH    KI+GPAY ++A
Sbjct: 29  SEETTSAAESAAPKKEMSFDEMYKDNPDYVEGLALVKESDCPSCHMVERKIVGPAYKDVA 88

Query: 75  KKYPATEKNINMLADKIIKGGTGVWGNMPMTAHATLKKDDAKLMVKYILSLKK 127
           +KY +T++NI  LA +++ G  GVWG +PM AH  L +DDAK MVKYIL LKK
Sbjct: 89  EKYESTDENIETLAKRVVDGNNGVWGQVPMPAHPGLSEDDAKKMVKYILMLKK 141


Lambda     K      H
   0.317    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 54
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 127
Length of database: 141
Length adjustment: 15
Effective length of query: 112
Effective length of database: 126
Effective search space:    14112
Effective search space used:    14112
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory