Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate Echvi_1862 Echvi_1862 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= BRENDA::Q99714 (261 letters) >FitnessBrowser__Cola:Echvi_1862 Length = 246 Score = 111 bits (277), Expect = 2e-29 Identities = 79/251 (31%), Positives = 128/251 (50%), Gaps = 22/251 (8%) Query: 12 VAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDV 71 +A++TGGASGLGLATA++ + +++ S ++LG NC + D+ ++ Sbjct: 5 IALVTGGASGLGLATAKKFCDHDITTIIIGRNESKLAKAQEELGPNCHYYAFDLNDLPNI 64 Query: 72 QTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTH-TLEDFQRVLDVNLMGTFNVIR 130 + + G++D+ VN AGI N+KK T E+FQ+++ N+ F++ R Sbjct: 65 PDLINTITTEHGKIDILVNNAGI-------NMKKPFIEVTDEEFQQIITTNVFAVFSLSR 117 Query: 131 LVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIG 190 +A M + G I+N +S+A+ G AY+ASK I GMT +A +L+P+G Sbjct: 118 EIAKTMASQ------KHGAIVNISSMASQYGIPKVIAYTASKSAIEGMTKAMAVELSPLG 171 Query: 191 IRVMTIAPGLFGTPL----LTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIEN--P 244 IRV +APG T + L PE+ L S+ P LG PA A V + Sbjct: 172 IRVNCVAPGFIATEMSAKALNGDPERKQKVL-SRTPM-GALGTPANIADAVYYLASESAS 229 Query: 245 FLNGEVIRLDG 255 ++ G ++ +DG Sbjct: 230 YITGTILPVDG 240 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 246 Length adjustment: 24 Effective length of query: 237 Effective length of database: 222 Effective search space: 52614 Effective search space used: 52614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory