Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate Echvi_2123 Echvi_2123 ABC-type spermidine/putrescine transport systems, ATPase components
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Cola:Echvi_2123 Length = 318 Score = 146 bits (369), Expect = 7e-40 Identities = 91/251 (36%), Positives = 149/251 (59%), Gaps = 17/251 (6%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M+ LK+ + KRY +A ++E+F+L + + VG SG GKS+ LR+IAGLE + G Sbjct: 1 MSYLKVSEVSKRY-DAGSLALEDFSLQVKRGGVVSMVGESGSGKSSLLRIIAGLEVQSAG 59 Query: 61 NLYI-DDKLMNDAS---PKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRV 116 +++ D K++N A P +I ++ Q Y LYP+ +V EN+A L L Y K +R Sbjct: 60 VVHLGDQKILNPAQKLVPGYDEIQLIHQEYKLYPNSTVEENIARPLLL--YDKAYQKERT 117 Query: 117 HEAAEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRA 176 E E+L L F ++KP LSGGQ+Q+VA+GRA+ + +V L+DEP S+LDA + + Sbjct: 118 AEILELLSLRAFKDKKPRQLSGGQQQKVAIGRALSIEPEVLLLDEPFSSLDAIQKRDLIE 177 Query: 177 EIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNE 236 E+ +I + T I+VTHD +A+ +++ ++I+ G++ Q G +E++ + Sbjct: 178 ELKEIFDALEVTVIFVTHDVDDALLMSEELLIIQK----------GKLLQQGNVREVFRK 227 Query: 237 PANKFVAGFIG 247 PA+ +VA G Sbjct: 228 PASAYVARLFG 238 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 318 Length adjustment: 29 Effective length of query: 348 Effective length of database: 289 Effective search space: 100572 Effective search space used: 100572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory